KEGG   Nothobranchius furzeri (turquoise killifish): 107392885Help
Entry
107392885         CDS       T05163                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
Arachidonic acid metabolism
Metabolic pathways
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:nfu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    107392885 (ptgs2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    107392885 (ptgs2)
Enzymes [BR:nfu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107392885 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
sgr17
AA seq 614 aa AA seqDB search
MRRSFWSMNRLTFALSLLALCFVCEGGNPCCSEPCQNRGVCTAMGADRYECDCTRTGYYG
QNCTTPEFLTRIKVSLKPSPNTVHHILTHFKAFWNIINSISFLRDAIMRYVLTSRSHMID
SPPTYNAHYGYKSWEAYSNLSYYTRALPPVPQDCPTPMGVVGKKELPDVKVLAEKLLVRR
KFIPDPQGTSLMFAFFAQHFTHQFFKSDMKNGPAFTVSKGHGVDLSHVYGVDLEKQHKLR
LFKDGKLKYQVINGEVYPPTVKDVGVEMHYPPHVPDSQRLAVGHEAFGLVPGLMMYATIW
LREHNRVCDVLKEVHPDWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPEL
LFNQRFQYQNRIASEFNMLYHWHPLMPDSFQVEKRDYSYKEFIFNTSVMTEHGISSLVES
FTNQIAGRVAGGRNVPGPILYVAMKSIEQSRQMRYQSLNAYRKRFSMKPYSSFEDLTGEK
EMAALLEEMYGDVDAVELYPGLLVEKPRPNAIFGETMVEMGAPFSLKGLMGNPICSPEYW
KPSTFGGSVGFDIVNSASLQKLVCNNVQGPCPVASFHVPDIKETGPTVINSSTSHAQASD
INPTIILKERTSEL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcgccggagcttttggagtatgaacagactcacatttgcgttgtccctgttggctctg
tgctttgtctgcgaaggaggtaacccctgctgctcagagccatgccagaacagaggtgtg
tgcacagcaatgggagcagacagatatgaatgtgactgcacacgtactggatattatggc
caaaactgcacaacgcctgaattcctcaccaggataaaagtctccctgaagccatcgcct
aacaccgttcaccacattctcacccacttcaaggctttctggaacatcatcaacagcatt
tcctttctcagagatgccatcatgagatatgtgctgacgtctcgatcccacatgattgac
agccctcccacttacaatgctcattatggttataaaagttgggaagcctactccaacctg
tcctactacacacgtgccctcccacctgtgccgcaggattgcccaacccctatgggagtc
gtaggtaaaaaagagctgccggatgtgaaggttttagctgagaagctcctggtgaggaga
aagttcattccagacccacagggtaccagcttgatgtttgccttctttgcacaacacttc
acgcaccagttctttaaatctgatatgaagaacggaccggctttcaccgtgtctaaaggt
cacggggtggacctgagtcacgtctacggtgttgacctggagaagcagcacaagctcagg
ctcttcaaggacggcaagcttaaatatcaggtaataaacggagaggtgtaccctccaaca
gtcaaggatgtgggtgttgaaatgcactacccccctcatgtcccagactctcagcgcctg
gccgtcggccatgaggccttcggtctggtccctggactcatgatgtacgccaccatctgg
ctccgtgaacacaaccgggtttgtgacgtcctgaaggaagtccacccagactgggatgac
gaaagactcttccagacctcccgactcatccttattggtgagaccattaagattgtgatt
gaggactacgtgcagcacctgagtgggtaccacttcaaactcaagtttgacccagagctg
ctctttaaccagcgcttccagtaccaaaaccgcatcgcatctgaattcaacatgctatac
cactggcacccactgatgccggacagcttccaggtggagaagagagattacagctacaaa
gagtttatctttaacacctctgtgatgactgagcacggcatcagcagcctggtggagtca
ttcaccaatcagattgcaggacgggttgctggtggccgtaatgtgccgggacccatcctg
tatgtggccatgaagtccattgagcaaagcaggcagatgcgttaccagtccctcaacgcc
tacaggaagcgattctccatgaagccttacagctcctttgaagacctgacaggcgaaaaa
gaaatggctgccttgctggaggagatgtacggtgatgtagatgccgtggagctctaccct
ggtctgctggtggagaaaccccgacccaacgccatcttcggggagacgatggtggagatg
ggcgctcctttctcactcaaaggcctgatggggaatcccatctgctccccggagtactgg
aagcccagcacctttggaggcagcgtgggcttcgacatcgtcaacagcgcctccctgcag
aagctcgtctgcaacaatgtgcagggcccctgtcccgtggcgtccttccatgtgcccgac
attaaagaaaccgggcccacggtcatcaactcaagcacatcccacgcccaagccagtgac
atcaaccccaccatcatcctgaaagagaggacatccgagctctaa

DBGET integrated database retrieval system