KEGG   Nothobranchius furzeri (turquoise killifish): 107394219Help
Entry
107394219         CDS       T05163                                 

Gene name
kmt5a
Definition
(RefSeq) N-lysine methyltransferase SETD8
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nfu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107394219 (kmt5a)
Enzymes [BR:nfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107394219 (kmt5a)
Chromosome and associated proteins [BR:nfu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107394219 (kmt5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 107394219
NCBI-ProteinID: XP_015828560
LinkDB All DBs
Position
sgr18
AA seq 335 aa AA seqDB search
MAKDNKRGPRTVKRSENTEHTVTSQTETKENKPANKDSAVKTPSILQTLQSPSKPRSPLG
ENSSTLIQEGNGSEATSSDSSKPKKDMPSKIKSESYEQKSEVTCPSPEETKQASDQPKQK
ETTKQSDVKSTVDAKDSAPKTKTKTGRKTRARKVENKGLQNRKVTDYFPIRRSNRKTKTE
IKSEEHKYIDDLIKNSTEEGMQVKHIEGKGRGVFAVKAFKKGDFVVEYHGDLLDLTEAKK
REAEYAKDPETGCYMYYFQYQSKTYCVDATKETDRYGRLLNHSKNGNCQTRLHSIDGKPH
LILVASRDIKSEEELLYDYGDRSKDSISAHPWLKY
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagataataaacgtgggccgagaaccgtcaaaaggtcagagaacaccgaacat
accgtcacgtcacaaacggaaacaaaggaaaacaagccagcaaacaaggattctgcagtt
aaaacaccatcaattctccagactctgcagagtccaagcaaacccagatctccattaggt
gaaaattcaagcacgctaatccaggagggaaatggttcggaggcaactagttcagattcc
tcaaagcctaaaaaagacatgcccagtaaaattaaatctgaaagctatgagcagaaatct
gaagtgacatgcccgagtcctgaggagacaaagcaagcttctgaccagcctaagcaaaaa
gaaaccaccaaacaatctgatgtcaaatctacagtggatgctaaagattcagcaccaaaa
actaagactaaaaccggccgtaaaaccagagcaagaaaggtggagaataaaggacttcaa
aacagaaaggtcacagactattttcccatcagacggagtaacaggaaaactaaaactgag
ataaagagtgaagagcacaaatacatagatgatctgataaagaacagcacagaagaagga
atgcaggtcaaacacatagagggaaaaggaagaggagtgtttgctgttaaggctttcaaa
aagggagattttgtagtcgaataccacggtgaccttctggacttaactgaggctaaaaag
agggaggctgagtatgccaaggatcctgaaacaggctgttacatgtactacttccagtat
cagtctaaaacttactgcgtggacgctacaaaggaaactgaccgttatggaagactgctg
aaccacagtaaaaatggaaactgccagacaaggctccattctatcgacgggaaacctcat
ttgatcttggtggcttccagagacattaaatcagaggaggagctactctacgactatgga
gatcggagtaaagactccatctctgcacacccttggctcaaatactga

DBGET integrated database retrieval system