KEGG   Nothobranchius furzeri (turquoise killifish): 107395695Help
Entry
107395695         CDS       T05163                                 

Gene name
setd2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nfu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107395695 (setd2)
Enzymes [BR:nfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107395695 (setd2)
Chromosome [BR:nfu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107395695 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 2559 aa AA seqDB search
MMFLIKHRQEGTGASVTVEGLSKSALIKSLSPRVILSNHLLTKGTKMRVNLEDQSRQKVS
FTFSQTKKPLQSSFFIHTSPETAVTELHSPSSQLSSDKEGKNMGRIKQKQTHLVSETNPE
THSQSSISSSTRLKKSLANMHFKKQILCVSVTEEKPAPSGSEEPHTSEQLHASELNILPK
STAKIYIEFPGLEPQNVISPSERAHIQISEIKEVPSLKKSSISSGKDGDSSRSTNLENNV
NKRKTRSQSSSVPLCSESYVDLAHTSSSHKSDDSKNRTNTDRIKEKSSSSNSHVGEREKK
SSKRSENHERSSSYSKSERDSRNMSSRSSRTDRDRHRSRSRSRSRSRGSRTSSSHSRSER
SRCDRGSRSERSYYHEFDRRLHKGSPSRKRRRSRSRTDRTWYSSDSEEDHRRLRTRTNVC
NRSSNYSSSHKVSQSSSHSKSEKSMKSEDSSHSSELNKKMHSSTFERTSKHYSDSDSQHK
CFPELDSSNRKSSGHHKSETSIISSASSNHSHSQTHNKHQKCTSSDSEGDHKAKLHASDK
CANSLKKCGDSRGNSSWSNSKKPTSHKTSVRSPRHVTQSIDLARSAEKSPLGALGTELCS
EDEQEKSELREGENEPSDVKEMVLSTDKRLQGFLSEARPRLELENKHTSSDSLKHGSSPE
NLHNVVSDLVSNNQPNVYLNAGILNSNKSDEKSIGVEDKKDVACLESPKPSLDFLDLPIT
QEVHQLTKPEESNITAMSQSDTTVPFPSELPCLETENQLSVDDDKKSISTTRKSRWDIVG
QKICDGDGSNRSACAEMKPAVKKVVSIRKIEFPKNNNKQESYSEEIVHSGDATHSRLINE
METSEQKGCSHRMSFICTNEDQSKRSQASTHIYSELPASQQSNSDEPLQINEKFSHNTLA
AEMQTHIRSDENKHRESTHSNRKSKITPATQDGSALLSDDSDNSAYDSDCEKALKLFHSV
VAIPKHSFLIEASDLRDESTHSPVIISNQPNTHQVSSQKTQPTSRSGVCASPNSSALCQS
QSNMIDSTSHSEGSGSRSAQLFVVSHVSETDSTHSPDNSRQYEDRLRLHEVGNNQAHLHY
QHEHFPGFDGINDKNDFSQVQVFFQSEQPSSTCQQPDSSHELQVTNTNLTGAVSRELSGT
KSYLHPHDREPFTEIHPDSLTNDYEDYSKNESSLNLNKRAAECCELHPTGSLSFVQAHEI
SSNSRGPAVSDPLQESNLRPHRGRGPPKKRRPEIESDSDNEAEAGPLGKRERHADAAVSK
ETVVKADGLQPSLSLQDFQDTNKWKELSKTKTMPPYFDLIEENLYLTERKKSKSHRDIKR
MQCECPVLSREDRAKGMFACGEDCLNRLLMIECSSRCFNGLYCSNRRFQMKQHADFEVIL
TEDKGWGLRAAKDLPPNTFVLEYCGEVLDHKEFKTRVKEYARNKNIHYYFMALKNNEIID
ATLKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKTVTAGNELTFDYQFQRYGKEAQ
KCFCGAPSCRGFLGGENRVSVRAAGGKMKKDRNRKSALTTVDEELEVLLENGEGLYDEKQ
VVSLCRLMVRVETMEQKLICLKLIQDTQNQSSLKQFLDHHGLSLLWIFMGLSEGKGESTN
NIKLQIEIMKTLAVLPISTKNMLEESKVLALIQRWAQTKTLPQQAEMDGYSSENTSRAQT
PLNIPDGSSTKMAPELDSDTSKPAVYQRLKIVSENSLDSALSDASKASDEKEEEEDEEEE
EDDDEKSHADFSERKRLKEAANRTKVSVEESVKEIVGEKLEKMETNSNDQQQLENMVSID
KNEFDVENKATEIKEDIRVAEAEEVEVLKFSCEEQDGVQRQSSQITPDETEMEEETSNHK
IESSGQSSQTIAANGPAEQPSASAKTQEAEMHPPSSELHLGESTTEAAFSSETPKVAVVL
EVKAMQVEASVIGTPSQDEEEGVSDVESERSQEPQLSALDISGMAGRLLESWKDLKEVYR
IPKKSQVEKETRDLSRDRDTSMTPHHTSGSRDREREREKDRERDRDRDYDRDWDRERDRD
RDRERDRDRVSDKTPRSSERRRRRSLSPPPSSYDRSSRRADERFDPSNSKMSRGAGGKER
NKLSTEERRKLFELEVAQREAQKQIQLQQQLQTMVYDPALTYVSSPSFITYPPGYPIQTF
VDPSNPNAGKVLLPTPPVEPTLTYDQTSPQRHISDLSVSSPSSTPQTTSVSNLSQHITTT
DLISSTPQQYVQQAVATQEAGLSVLSVPTQSAPQVHGQQSYTTLWDPSTQQAVAVQTQPA
QQYATAPGPAQTQTAIYYQGQPCQTIYSIPAAYPQTSTPVIQAYTEPTASYLHGQPVYPG
HQQGVVVQQGGTVTTIVTSQTLQQELIVPNNVIDLPPPSPPKPKTIVLPPNWKVARDPEG
KIYYYHIVTRQTQWDPPNWDGSSEGTSVDHESEMDLGTPTYDENPSKFSTKTAEADTSSE
LAKKSKETFRKEMSQFIVQCLNPYRKPDCKSGRISNTEDFKHLARKLTHGVMNKELKACK
NPEDLECNENVKHKTKEYIKKYMQRFGSMYKPKEDTEVY
NT seq 7680 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcttgattaaacatagacaggaagggactggtgcttcggtaacagtggaagga
ttgtccaagtcagctctgataaagagcttgtcacccagagttattttatccaatcatctc
ttaacaaaggggaccaaaatgagggtcaaccttgaagatcagagccgtcagaaagtgtcc
ttcaccttctcgcagacaaagaagcctcttcagagttcgttcttcatccacactagtcct
gaaacagctgttactgaacttcactctccttcgtcacagttatcgtcagataaagagggg
aaaaatatggggagaataaagcaaaagcagacacacttggtgtcagagactaacccagag
acacactctcaatcatcaatctcttcttcaactagactcaaaaaaagtttagcaaatatg
cattttaagaagcaaattctttgtgtgtctgtgactgaggagaaaccagcaccttctgga
tcagaagagcctcacacctctgaacagcttcatgcctctgaactgaacattttgcctaaa
tcaacagctaagatttacattgaattcccagggctcgaaccacaaaatgttatcagcccc
agtgaaagggctcatattcaaatttctgagataaaggaagtccccagcctaaagaagtcc
tccatttcctctggaaaggatggtgatagttccagaagtactaatctcgaaaataacgtg
aacaaaaggaaaaccaggtcacagtccagtagtgttcctctttgctcagaatcctatgta
gatttagcccacacgtcttccagtcacaagtctgatgattcaaaaaacagaacaaacact
gatagaatcaaagagaaaagctcctcctctaattcacatgttggggaaagagaaaagaag
tcctctaagcgttcggagaatcatgaaaggtcttctagttattccaaatcggagcgagat
tctagaaacatgtcctcacgctcgtctcgaacagacagggatcgccataggtccaggtct
agatcacgatctagatccagggggtctcgaacaagttcatctcactccagatcagagaga
tccagatgtgacagaggatctcgctctgaaagatcatattatcatgagtttgatcggcga
ttgcacaagggttctccttccagaaagaggagacgttctcgttcccgcactgacagaact
tggtatagttctgactctgaagaagaccaccggagattgcggacaaggacaaatgtgtgc
aaccggtcgtccaactactcaagctcccataaagtgtcacaatcatcttcccactcaaaa
tcagagaaatctatgaagtctgaagattcttctcactcctctgagttaaacaagaaaatg
cattcatcaacgtttgagaggacttcaaagcattattcagactcagattcccaacacaag
tgctttcctgagttggactctagtaaccgcaaatctagtggacatcataaatccgagacc
agcatcatttcttctgcttccagtaatcattcccactctcaaacacacaacaagcaccaa
aaatgcacttccagtgactcggagggagatcataaagcaaaattgcatgcatctgacaaa
tgtgcaaactctttaaagaaatgtggagactctcgggggaatagcagttggtcaaattca
aagaagccaacctcccataaaacatctgtgagatctcctagacatgttacacaatctatt
gacttggctcgcagtgctgagaaatcaccactgggtgcacttggcacagaattgtgttct
gaagatgaacaagaaaagtcggaattacgtgaaggtgagaatgaacccagtgatgttaag
gagatggtcttatccactgacaaacgtttacaaggatttttaagtgaagcaaggccaagg
cttgaattggaaaataaacatacatcaagtgatagtctaaagcatggaagcagtcctgaa
aatctgcacaatgtggtgtctgatttagtctcaaataatcaaccgaacgtttatttaaat
gctggcattctgaattctaacaaaagtgatgaaaagtcaataggtgtcgaagacaagaaa
gatgtagcctgtttagaatcacccaaaccttctctggattttttagatttacccatcaca
caggaggttcaccaactcactaaaccagaagagtcaaatataactgctatgagtcagtct
gacacaactgtgccattcccatctgagttgccatgtcttgaaactgagaatcagttgtct
gtggatgatgataaaaagagcatctctaccaccagaaagtcccggtgggatattgttgga
caaaaaatatgtgatggtgacggttcaaacagatctgcttgtgcagaaatgaagcctgca
gtgaaaaaggtggtatccattaggaaaatagagttccctaaaaacaacaacaaacaagag
tcttacagtgaagaaattgttcattcaggagacgcgacacattccagactaataaatgag
atggagacctctgagcagaaaggctgctcacaccgcatgtcctttatctgtacaaacgaa
gaccaaagtaaacgttcacaagcaagcacccacatttactcagaacttcctgcttctcag
caatcaaactcagatgagcctctccaaataaacgaaaaattttcacacaataccttggct
gcagagatgcaaacccatatcagatctgatgaaaacaaacacagagagagcacccacagc
aacagaaagagtaaaataacaccagccacccaggatgggtcagcgctactcagtgatgac
agtgacaactctgcgtatgattcagattgcgaaaaggctttaaaactgtttcactctgtg
gtggcgataccaaagcattcttttctgatagaagcatcagatctcagggacgagtctaca
cactctccagttatcatttccaaccagcccaacactcaccaggttagctcacagaaaaca
caaccaacatccaggagtggtgtatgtgcgtctccaaacagcagtgcgttgtgtcagtcc
caaagcaatatgatcgacagcaccagtcactcagaaggctctggctccagaagtgcccag
ctctttgtggtcagtcatgtcagtgaaaccgattcaacccactcgcctgataattccaga
cagtatgaggatagactcaggctgcatgaggttggtaataaccaggcacacttgcattac
caacatgagcattttcctgggtttgatggtataaatgacaagaatgatttcagccaggtc
caggttttttttcaatcagaacagccttcaagtacgtgccagcagcctgacagcagccac
gagctgcaggtaacaaacacgaacctgacaggagctgtttccagagagctaagtggcaca
aaatcttacctccatccacacgatcgggaaccttttactgaaatccaccctgattcactt
actaatgactatgaggactacagcaaaaatgaatcatcgttgaatcttaataaaagagct
gctgaatgctgtgagcttcatcctacaggatcattgagctttgtacaagctcatgaaatt
agcagcaacagcaggggccctgctgtatctgacccccttcaagaaagcaatttgagaccc
cacagaggcagaggacctcccaagaaaagacgtccagaaatcgagtcagactccgacaat
gaggcagaagctgggcctttgggcaaaagggagcgtcatgcagatgctgctgtttctaag
gaaacagtggttaaagctgatggtcttcagccgtcactgtctctgcaggactttcaagat
acaaacaaatggaaagaattgtccaaaactaaaacaatgcccccctactttgacttgatt
gaggagaacctctacctaactgaaagaaagaagagcaaatctcatcgagacatcaaaagg
atgcagtgtgagtgtccagtgttgtcaagagaagatcgcgcaaaaggaatgtttgcttgt
ggggaagactgtttgaatcgactcctgatgattgaatgctcatcgcgatgcttcaacgga
ttgtactgttctaaccgccgcttccagatgaaacagcacgcagactttgaggttatcctc
acagaagataaaggctgggggctgcgtgcagctaaagatttacctccaaacacatttgtc
ctggaatactgtggagaggtgttggaccacaaagagttcaaaacgagggttaaagaatat
gctcgcaacaagaacattcactactattttatggctctgaagaataatgagattattgat
gcaacactgaagggaaattgctctcgattcatgaaccacagctgtgagcccaattgtgag
acccaaaagtggactgttaatggtcagcttcgagttgggttcttcaccaccaagactgtc
actgcaggaaatgaactgacgtttgactaccagtttcagagatacggaaaagaagcacag
aaatgtttctgtggggcgcccagctgcagaggcttccttggtggggagaacagagtcagc
gttcgagcggcaggggggaagatgaagaaagatcgcaatcgaaagagtgctctcaccacg
gtggatgaggaactcgaggtgttgctggagaatggagagggtctgtatgatgagaagcag
gtggtgtctctctgcaggctgatggtccgagtggaaaccatggagcagaaacttatctgt
ctcaagctcatacaagatacacagaaccaatcaagcctgaagcagttcttagatcatcac
gggctgtctttgttgtggattttcatggggctctctgagggtaaaggcgaaagcaccaac
aacatcaagctgcaaatagagattatgaagaccctggctgtgctccccatctctaccaag
aacatgctggaggagagcaaagtccttgcccttattcagcggtgggctcagacgaaaact
cttcctcagcaagctgagatggatggctactccagtgagaacacctcccgagcccaaact
ccactcaacattcctgacggttcctccaccaaaatggcaccagaactggacagcgacacc
tccaaacctgctgtataccaacgccttaaaattgtgagtgaaaatagcctggacagcgct
ctgtctgatgctagcaaagcctctgacgagaaggaagaagaggaggacgaggaggaagag
gaggacgatgatgaaaagtctcatgcagatttttctgaaagaaaaaggttgaaagaagca
gcaaaccgaactaaagtgtcggtggaggagtctgtgaaagagattgtgggagaaaaactg
gaaaagatggagactaattcaaacgatcaacaacaacttgagaatatggtcagtatagac
aaaaatgagtttgatgtggaaaataaggctacagaaattaaggaagacataagagtggct
gaggcagaagaagtcgaggtattaaaattttcttgtgaagaacaggacggtgtacaacgg
cagagcagccagatcacaccagatgagactgaaatggaagaagaaacatctaatcacaaa
attgaatcaagcggtcagtccagtcaaacgattgctgctaatggtccagctgagcaacca
tcagcatctgcaaagactcaagaggcagagatgcatcctccgagcagcgagctacacctt
ggtgaatctaccaccgaggccgcctttagttcagagaccccaaaggttgcagtcgtcttg
gaggtcaaagcaatgcaggtagaggcatcagtgataggaactccttctcaggatgaagag
gagggcgtctcagatgtggaaagtgaaaggagtcaagagcctcaactcagtgccttagac
ataagtgggatggctggtaggcttctggaaagctggaaggatctgaaggaggtatacagg
ataccaaagaagagccaggtggaaaaggaaacaagagatctcagccgagatcgagacacg
tccatgactccacaccacacttcaggcagccgagatagagaacgggagcgagagaaggat
agagaacgtgacagagatcgagattatgatcgagactgggacagggagcgagatcgggac
agagacagagaacgggacagggacagagtctcagacaaaactccacgtagttctgagcgg
cgacgaaggcgctccctgtctccgccaccttcatcctatgatagaagcagccgacgtgcc
gatgaacggtttgacccatcaaacagcaagatgtcgaggggagctggtggtaaggaacgc
aataagctgtccacagaggagcgaaggaagctgtttgaactggaagtcgcccagagggaa
gctcagaagcagatacagcttcagcagcagctccagactatggtttatgatcctgcttta
acctatgtgtccagccccagcttcatcacctaccctcctgggtaccccatacagaccttt
gtggacccctccaaccctaatgcaggcaaagtcctcctccctacccctcctgttgaacca
acccttacctatgatcagacttctcctcagcgccatatctcagacctgagcgtgtcctct
ccatcctccacaccccagacaacatcagtctctaatctctctcagcacatcaccaccaca
gacctcatcagcagcacccctcagcagtatgtccagcaagctgtagcaacacaggaggct
gggctatctgttctctcggtgccgacccagtcagcccctcaagtgcatggccagcagagc
tacaccactctctgggatccaagtacccagcaggctgtggcagtgcagacccagccagct
cagcagtacgccacagctccgggaccagctcagactcagacggccatctattaccagggt
caaccatgccagacgatctacagcatccctgctgcatatcctcagaccagcactcctgtc
attcaggcctatacagagcccacagccagctacctacatgggcagccagtgtatcctggc
catcagcagggagtggtggtgcagcagggaggcaccgtcaccaccatcgtcacatcccaa
acccttcagcaggagttgattgtacccaacaatgtgatcgacctgcctcctccctctcct
ccaaaacccaaaacaattgtcctacctcctaactggaaagtggcccgggatcctgaaggc
aagatttactactaccatattgtcacgagacagactcagtgggatccacccaactgggat
ggaagtagtgaaggaaccagcgtagaccatgaatctgagatggacctgggaacacccacc
tacgatgagaatccttccaagttctctactaagacagctgaagcagacacttccagtgaa
ttggcgaaaaaaagtaaagagacatttcggaaagagatgtcccagttcatagtgcagtgc
ctgaatccttatcggaagcccgactgcaaatctggtcgcatcagtaacactgaggatttc
aaacacctggcgagaaagctaacgcacggagtcatgaataaggagctgaaggcttgcaag
aaccctgaggaccttgagtgcaatgagaatgttaagcacaagaccaaggagtacatcaaa
aagtacatgcagagatttggctccatgtacaagcccaaggaggacacggaggtgtactga

DBGET integrated database retrieval system