KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH33060Help
Entry
RG540_CH33060     CDS       T03244                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Pathway
ngg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ngg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RG540_CH33060
Enzymes [BR:ngg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RG540_CH33060
Transporters [BR:ngg02000]
 Other Transporters
  Pores ion channels [TC:1]
   RG540_CH33060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: CDN49470
UniProt: A0A068SWP6
LinkDB All DBs
Position
3302364..3303089
Genome map
AA seq 241 aa AA seqDB search
MTYELYYWDGLQGRGEFVRLALEEAGADYVDVARGERGTAKMMNYMHGKHGYDMPFAPPF
LKDGDLIVSHVANILNYLGPKLDLVPKDEKSRLFAHGLQLTITDFLAEVHDTHHPISTAD
YYEDQRPEAKARSKAFLKHRVPKFIGYFDRIIAANPTKSGYALGDTLTYVDLSLFQLAKG
LAYAFPRAMKNFDNDYPRVAKLRDAVAERPNIEAYLRSKRRLAFNESGIFRHYPDLDQDP
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgaactttattactgggacggccttcagggccgcggcgaattcgtacggctg
gcgctggaagaggctggagccgactatgtggacgtagcccgcggcgaacgcggtactgcg
aaaatgatgaactatatgcacggcaagcatggttacgacatgccgttcgcaccgcccttt
ctcaaggatggcgacctgatcgtctcccatgtcgccaacatcctcaattacctcgggccg
aagctggatctggtgccgaaagacgagaaatcccgcctcttcgcccacggcctccagctg
acgatcaccgatttcctcgcggaagtgcacgatacgcaccacccgatcagcaccgccgac
tattatgaggatcagaggccggaggccaaggcgcgttccaaggccttcctgaaacaccgg
gtgccgaaattcatcggctatttcgaccgcatcatcgccgcaaaccctaccaagagcggc
tatgcgctgggcgacaccctgacttacgtcgacctgtcgctcttccagctagccaaaggt
ctcgcctatgccttcccgcgcgccatgaaaaatttcgataatgattacccccgtgtcgcc
aaactacgcgatgcggtcgccgaacgtccgaatatcgaggcctatctaaggtcgaaacgc
cggctcgcgttcaatgagtcgggcatattccggcattatccagaccttgatcaggatccg
gcctga

DBGET integrated database retrieval system