KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103729965Help
Entry
103729965         CDS       T03372                                 

Gene name
Kmt2b
Definition
(RefSeq) lysine methyltransferase 2B
  KO
K14959  histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ngi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103729965 (Kmt2b)
Enzymes [BR:ngi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103729965 (Kmt2b)
Transcription factors [BR:ngi03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    103729965 (Kmt2b)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103729965 (Kmt2b)
   HMT complexes
    MLL3/MLL4 complex
     103729965 (Kmt2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET FYRC PHD FYRN zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 SDA1 Bromodomain PHD_2
Motif
Other DBs
NCBI-GeneID: 103729965
NCBI-ProteinID: XP_008826300
LinkDB All DBs
Position
Un
AA seq 2819 aa AA seqDB search
MGPQDTSPSRSNLLAGTLVCMRPAQAGEERRLGSWFRLLPPLPEHKGSETSSLASPFCAV
QCCYRVAPGTATNQATPPSSRALVVGGRNRASGLHFPGNLAPSLSGRDAGSALQVRSEGD
GRRASDSCSRGAPRVAGPPPAAARPAAALFVVGLRRGLRRLRRLWAGPRVQRGRGRGRGR
GWGLSRGCVQEEESSDGDSDEEEFQGFHSDEEVAPSSLRSALRSQRGRAPRGRGRKHKTT
PLPPRLADVAPVPAKTPARKRGEEGTERMVQALTELLRRAQAPPAPRSRTCEPSAPRRSR
GRPPGRPSGPCRKKQQAVVVAEAAVTIPNPEPPPPVVPVRHRTGSWKCKEGPGPGPGTPR
RGGQPGRGGRGGRGRGRGGIPLMIKFVSKAKKMKSGQLSLELESGQGQGQHEESWQDASQ
RRVGAEQEADSCWKKQEQKLEEEGEEEEEGEEEEEEEEGKGKEEGEKEEDEEEKAVAEEE
VILAKEKEEAKPPSPPRTPPAPSPSPPLPSLPPPPPLLPPPSTSPPPPSPPPXASPPPHP
APEKQEESPPIVPVTCSRKRGRPPLTPSQRAEREAARAGPEGTFSPTPNASTTTGGPLED
SPTVAPKSTTFLKNIRQFIMPVVSARSSRVIKTPRRFMDEDPPKPPKVEVSPVFRPPVAT
SPLAPQEAVPVPSPPRVPTPPSIPVPLPEKRRSILREPTFRWTSLTRELPPPPPAPPPAS
SPPASSPPPAPATPSRRPLLLRAPQFTPSEAHLKIYESVLTPPPLGVPEAPEPEPPPADD
SPAEPEPRAVGRTNHLSLPRFAPVVTTPVKVEVCPHGAPSLSSGQQLQTQLQQPLQALQS
QLLPQALPPQQPQVHPHVQPQLQLQPAPSSQHTPPLEKVRVTSMGSLPLSGVEEKMFSLL
KRAKVQLFKIDQQQQQKVAASMPPSPAIQMEESVGTVKQTPDRGSVKSEDESVEAKRERA
SGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDLATEDTSSASETE
SVPSRSQREKVESAGPGGDLEPAGTAGALAHTPRRPLPSHHGKKMRMARCGHCRGCLRVQ
DCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMERLAKKGRTIVKTLLPWDSDESP
EASPGPPGARRGAGAGGPREEVGATPGPEEQDSLLLQRKSARRCVKQRPSYDVFEDSDDS
EPGGPPAPRRRTPREHELPMLEPEEQSRPRKPTLQPVLQLKARRRLDKDALAPGPFASFP
NGWTGKQKSPDGVHRVRVDFKEDCDLENVWLMGGLSVLTSVPGGPPMVCLLCASKGLHEL
VFCQVCCDPFHPFCLEETERPLPQHHDTWCCRRCKFCHVCGRKGRGSKHLLECERCRHAY
HPACLGPSYPTRATRRRHHWICSACVRCKSCGATPGKNWDVEWSGDYSLCPRCTELYEKG
NYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPDSVLYTCGPCAG
ATQPRWREALSGALQGGLRQVLQGLLSSKAAGPLLLCTQCGQDGKQLHPGPCDLQAVGQR
FEEGHYKSVHSFMEDMVGILMRHSEEGETPERRAGGQMKGLLLKLLESAFGWFDARDPKY
WRRSTRLPNGVLPNAVLPPSLDHVYAQWRQQESETPESGQPPGDPSAVVQSKDPAAFSHL
DDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGSLKNVHAAVAR
GRQMRCELCLKPGATVGCCLSSCLSNFHFMCARASYCIFQDDKKVFCQKHTDLLDGKEIV
TPDGFDVLRRVYVDFEGINFKRKFLTGLEPDVINVLIGSIRIDSLGTLSDLSDCEGRLFP
IGYQCSRLYWSTVDARRRCWYRCRILEYRPWGPREEPVHLEAAEENQTIVHSPTHSSEPL
NHEDLPDTNSLIPGAPENYSPIQNLEPLLRPDSSSAPPLTPRSFSGARIKVPNYSPSRRP
LGGVSFGPLPSPGSPSSLTHHIPTVGDPDFPAPPRRSRRPSPLTPRPPPSRRASSPLRTS
PQLRVPLSTSVTALTPTSGELAPHGLAPSPLPPPEDLGPDFEDMEVVSGLSAADLDFAAS
LLGTEPFQEEIVAAGAVGNSQGGPGDSSEEEASPTTHYVHFPVTVVSGPALAPSPLSGVP
RIEQLDGVDDGTDSEAEAVQQPRGQGTPPSGPVVGRGGVLGAAGDRARPPEDLPSEIVDF
VLKNLGGPGEGAAGPREESLPIAPPLANGSQPSQGLPPSPADPTRTFAWLPGAPGVRVLS
LGPAPEPPKPATSKIILVNKLGQVFVKMAGEGDPVPPPVKQPPLPPIIPPTTPTSWTLPP
GPLLSVLPVVGVGVVRPAPPPPPPPLTLVFSSGPPSPPRQAIRVKRVSTFSGRSPAPPPN
KAPRLDEDGESLEDTPQIPGISGSGFSRVRMKTPTVRGMMDLDNPGEPPGEESPGPFQDR
YPLLPLPEGPPRSADGPSDLLLESQWHHYSGEASSSEEEPPSPEDKENQAPKRAGPHLRF
EISSEDGFSVEAESLEGAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGIHHDAVIFLA
EQLPGAQRCQHYKFRYHQQGEGQEEPPLNPHGAARAEVYLRKCTFDMFNFLASQHRVLPE
GATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKKTSKEAVGVYRSAIHGRGLFCKRNID
AGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNAARFINHSCE
PNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGAKRCRRFLN
NT seq 8460 nt NT seq  +upstreamnt  +downstreamnt
atggggccccaagacaccagtccctcccggagcaatctcctcgcggggactctagtttgc
atgcgcccagcccaggctggagaggagcgcaggctcggatcctggtttcggctgctgcct
cctcttcccgagcacaagggtagcgagactagctctctcgcatctcccttctgcgccgtg
cagtgctgctaccgggttgcacctggaaccgcgactaaccaagcgacgcctcccagttct
cgcgccctagttgtgggcggaaggaaccgggcgtctggactacatttcccagggaacctt
gcgccttccctgtccggccgagacgcagggtctgcacttcaggtgcggtctgagggtgac
ggccgacgggcctcggactcctgctcccgtggtgccccgcgcgtggccggcccaccgcca
gctgccgcccgccccgcggcggcgctgtttgttgtcggactccgccggggcctgcgccgg
ctccgccgcctgtgggctggcccgcgcgttcagcgaggccggggccggggccggggccgg
ggctggggcctgagccgaggctgcgtgcaggaggaagagagcagtgacggggactccgac
gaggaggagtttcagggttttcattcagatgaagaagtggctcccagttccctgcgctct
gcactccgatcccagcgaggtcgagcccccagaggtcgtgggcgaaagcataagacaacc
ccccttcctcctcgactagcagatgtggctcctgtccccgcaaagacccctgctcggaaa
cggggtgaggagggcacagaacggatggtgcaggcactgactgaactgctccggcgggcc
caggcacccccagccccccggagtcggacatgtgaaccctctgctccccgacggtctcgg
ggacggcccccaggacggccttcaggcccctgccggaaaaagcagcaagcagtagtcgta
gcagaagcggctgtgacaatccctaaccccgagcctccacctcctgtggttccagtgaga
caccgaactggcagctggaagtgcaaggagggaccaggtccgggacctgggacccccaga
cgtggaggacagcctgggagaggaggccgtggaggcaggggcagaggccgaggtgggatt
cccctcatgatcaagtttgtttcaaaggccaaaaaaatgaagtcgggacaattatctctg
gaactagaatcaggtcagggtcaaggtcaacatgaggaaagttggcaggatgcctcccaa
agaagagttggagctgaacaggaagcggactcttgttggaagaagcaggagcagaaactg
gaagaagagggagaagaggaggaggagggagaagaggaagaggaagaagaggagggaaaa
ggcaaagaagagggagagaaggaagaagacgaggaggaaaaagctgtggctgaggaagag
gtgatactggccaaggagaaggaagaggcaaagccaccatcaccaccccggactcctcca
gctccttcaccttctcctcctcttccttctcttcctcctcctcctcctcttctcccaccc
ccttcaacatctccacccccaccatcccctccaccnncagcatcccctcccccgcatcca
gccccagagaagcaggaagagtcccctcctatagtcccagtgacatgctccaggaagagg
ggccggccccccctgactcccagccagcgggcagagcgggaagctgctcgggcagggcca
gagggcaccttttctcccactccgaatgccagcaccaccacaggaggccctctggaagat
agccctactgtggcccccaaaagtactaccttcctgaagaatatccgacaatttattatg
cctgtagtgagtgcccgctcctcccgtgtcatcaagactccccggcgatttatggatgaa
gatcctcccaaacctccaaaggtggaggtctcacctgtttttcgacctcccgttgcaacc
tccccacttgctccccaggaagcagtgccagtcccctctccacctcgcgtcccaaccccc
ccatctatcccagtcccacttcctgagaagagacgttccattctaagggaacccacattt
cgttggacctcactaacccgggagctgccacctcctcctcctgctcctccaccagcctca
tctccgccagcttcatcccctccacctgcccctgccactccctcccggaggcccttgctc
cttcgggcccctcagtttaccccaagtgaagctcacctgaagatctatgaatcggtgctt
actcctcctcctcttggggttcctgaagcccctgagccagagcctcctcctgctgatgac
tctccagctgagcctgagcctcgggcagtggggcggaccaaccacctcagcttgcctcga
tttgcccccgtggtcaccactcccgttaaggtcgaggtatgcccccatggagctccatct
ttgagcagcgggcagcagcttcagactcagctacagcagcccctgcaggccttgcagtcc
cagctcctgccccaggcactacccccacagcagccacaagtacacccacacgtacagcca
cagttacagctgcaaccagctccatcatcacaacacacaccacctctggaaaaggtccgt
gttacaagcatgggttccctgccactgtctggggtggaagaaaaaatgttcagccttctc
aagagagctaaggtgcagctattcaagattgaccagcagcagcagcagaaagtggcagct
tcaatgccgccaagccctgcaatacaaatggaggagtctgtagggacggtcaagcagacc
ccagacagaggctctgtcaagtctgaagatgaatccgtggaagctaagagagagcgagct
tcgggccctgagtcccctgtgcaaggccctcgcatcaaacatgtttgccgtcatgctgct
gtggctctgggtcaggctcgggccatggtgcctgaagatgtcccccgcctcagtgccctt
cctctccgagaccggcaagaccttgccacagaggatacatcgtcagcatctgagactgag
agtgtcccatcccggtcccagcgggaaaaggtggaatctgcagggcctgggggagacttg
gagcctgcagggactgcgggggccctggcccacaccccccgacgcccactgccctcccac
cacggcaagaagatgagaatggctcgttgtgggcattgtcggggttgcctgcgtgtgcag
gactgtgggtcttgtgtcaactgcttggacaaacccaagtttgggggccccaacaccaag
aagcagtgctgtgtataccggaagtgtgacaaaatagaggctcggaagatggagcggctg
gcaaaaaaaggccggacgatagtgaagacgctgttgccctgggattccgatgaatctcct
gaggcctcccctggtcctccaggcgcacgccggggggcgggagctggggggccccgggag
gaggtgggagccacccccgggcccgaggagcaggactccctcctactgcagcgcaagtca
gcccgacgctgcgtcaaacagcggccctcctatgatgtcttcgaggactcagacgactca
gagcccgggggtcctcctgctccgagacgtcgaacccccagagaacatgagctgccaatg
ctagaacctgaggagcagagccggccccgcaaacccaccctgcagcctgtgttgcagctc
aaggcccgaaggcgcctggacaaggatgctttagcccctggcccctttgcctcttttccc
aatggctggactggaaaacagaagtcccctgatggtgtgcaccgggtccgagtagatttt
aaggaggattgtgaccttgagaacgtctggctgatgggtggtcttagtgtgctcacttct
gtgccagggggaccaccgatggtgtgcctgctatgtgctagcaaaggcctccacgagctg
gtcttctgccaagtctgctgtgaccctttccacccattctgcttggaggagactgagcgg
cccttgccacagcatcatgatacctggtgctgccgccgctgcaaattttgccatgtctgt
ggacgcaaaggccgaggatccaagcaccttctggagtgtgaacgttgccgccatgcttac
cacccagcctgcctgggtcccagctacccaacccgggctactcgtagacgacaccactgg
atctgttcagcctgtgtgcgctgtaagagctgtggggcaactccaggcaagaactgggat
gtcgagtggtctggagattacagcctctgccccaggtgcaccgagctctatgagaaagga
aactactgcccaatttgtacacgctgctatgaagataacgactatgaaagcaagatgatg
cagtgcgcacagtgtgaccactgggtgcatgccaagtgtgagggactctcagatgaagac
tacgagatcctttctgggctgccagactcagtgctgtacacatgtggtccgtgtgctggg
gcgacacaaccccgctggcgagaggccctaagtggggccctacaggggggcctgcgccag
gtgctccagggcctgctgagctccaaggctgcgggcccactgctactgtgcacccagtgt
gggcaggatgggaaacagctacacccaggaccctgtgatttgcaagctgtgggtcagcgc
tttgaggaaggccactacaaatctgtgcacagtttcatggaagacatggtaggcatcctg
atgaggcactcagaagaaggagagaccccagagcgccgggctggaggtcagatgaaggga
ctcctattgaagctgctagagtctgcattcggctggttcgatgcccgcgaccccaagtac
tggcgacgaagtacccggctaccaaacggagtcctccccaatgcggtgttgcccccatct
ctggaccatgtctatgctcagtggagacagcaggaatcagagaccccagaatctggacag
cctccaggagatccctcagcagttgtccagagcaaggatccagctgctttctcacacctg
gatgatccccgccagtgtgcactctgtctcaaatatggggatgctgactccaaggaggca
gggcggctcctgtacattgggcagaatgagtggacacatgtcaattgtgccatttggtcc
gctgaagtgtttgaggagaatgatggctccctcaagaatgttcatgctgctgtagcacga
gggagacagatgcgctgtgagctctgcttgaagcccggagccacagtgggctgctgcctg
tcctcgtgcctcagcaacttccacttcatgtgtgcccgggccagctactgcatcttccag
gatgacaagaaggttttctgccagaaacacacagacctcctagatggcaaggagattgtg
acccctgatggttttgatgttctccgccgagtctatgtggactttgagggtatcaacttc
aagcgaaagttcttgactgggcttgaacctgatgtcatcaatgtactaataggctcaatc
agaatcgactccctgggcaccctgtctgatctctcagactgtgagggtcggctcttcccc
attggctatcagtgctcccgtctatactggagcacagtagatgctcggaggcgctgctgg
tatcggtgccgaattctagagtatcgtccgtggggaccaagggaggagccggttcacctg
gaggctgcagaggagaaccagaccattgtgcatagccccacccattcttcagagcccctt
aatcatgaggacctgccagatacaaattctctgatccctggagctcctgaaaactactcg
cccattcagaatctggaacccctgcttcggccagattcaagcagtgctcctcctcttact
ccccgctccttttcaggggctcgaatcaaagtgcccaactactcgccatctcggaggccc
ttagggggtgtctcctttggccccctgccctcccccggaagtccatcttctctgacgcac
cacatccctacagtgggagacccggacttcccagctccccccaggcgctcccggcgtcct
agccccttgacccctagaccgccaccatcacggcgggcctcctctcctctcagaacttcc
cctcagctcagggtgcccctgtctacctcagtcacagccctcacacctacctcaggggag
ctggctccccatggcctggccccatctcctctaccaccccctgaagacctgggcccagac
tttgaagacatggaggtggtgtcaggactgagtgctgctgacctggactttgcagccagc
ctgctggggactgaacccttccaagaagagattgtggctgcaggggcagtggggaacagt
caggggggcccaggagacagctcagaggaggaggccagtcctactacccactacgtccac
ttccctgtgacggtggtgtctggccctgccctggccccaagtcccctctctggagtaccc
cgaattgagcagctggatggagtggatgatggcaccgacagtgaggctgaggctgtgcag
caaccccggggacaggggactcctccttcaggaccagttgtgggccgaggtggggtcctc
ggtgctgcaggagacagagcccgacctcctgaagacctgccttcagaaattgtggatttt
gtgttgaagaacctagggggtcccggggagggagctgctggtcccagagaggagtcactt
cctatagcacctcccttggccaatggcagccagccctcccaaggcctgccccctagccca
gctgaccccacacggacatttgcctggctccctggggctccaggggtccgggtgttgagc
ctgggccctgctcctgagccccctaagcctgctacatccaagatcatccttgtcaataag
ttggggcaagtatttgtgaagatggctggggaaggtgatcctgtcccacctccagtaaag
cagccacctctaccccctatcattcctcccacaacccccacttcctggactctgccccca
ggacccctgctcagtgtattgccagtggtaggggtaggagtggttcgccctgccccacct
ccacctccgcccccactcactctggtgttcagcagtgggccacccagcccacctcgccag
gccatccgtgtcaagagagtgtccactttctctggtcgttctccggctcctcccccaaac
aaagccccccggctggatgaagatggagagtccttggaggatacccctcaaattccaggg
atcagtggcagtgggtttagtcgcgtgcgcatgaaaacacccacagtacgtggtatgatg
gacctggacaatcctggggaaccccctggggaggaaagcccagggcctttccaggaccgg
taccctttactgccacttccagaaggtcctccccggtctgctgatggcccctcagacctg
ctgcttgagtcccagtggcatcactattcaggtgaggcctcgagctctgaggaggagccc
ccatccccagaggacaaagaaaaccaggctccaaaacgagctggcccacacttacgcttt
gagatcagcagtgaggatggcttcagtgtggaggctgagagcttggagggggcctggaga
actctgattgagaaagtgcaagaggcccgagggcatgcacggctcaggcatctctccttt
agtggaatgagtggggccaggctcctgggcatccaccacgatgctgtcattttcctggca
gagcagctgcctggggcccagcgctgccaacactataagttccgctaccaccagcaggga
gagggccaggaagagccgcctctgaatccccatggggctgcccgtgctgaggtctatctc
cggaagtgtacctttgacatgttcaacttcctggcctcccagcaccgggtgcttcctgag
ggggccacctgtgatgaagaagaggatgaggtacagcttaggtctaccagacgtgccacc
agtctggagctgcccatggccatgcgctttcgccacctcaaaaagacatccaaagaggct
gtgggtgtctacagatcagccatccatgggcgaggcctgttctgtaaacgtaacatcgat
gctggtgagatggtcattgaatactctggcattgtcattcgctctgtgctgactgacaag
cgggagaaattctatgatggaaagggtattgggtgctacatgttccgcatggatgacttt
gatgtggtggatgccacgatgcacggcaatgctgcccgcttcatcaaccactcatgtgag
cccaactgcttctctcgtgtcatccacgtggaaggccagaaacacattgtcatctttgcc
cttcggcgcatcctgcgaggtgaggagctcacctatgactacaaatttcccatcgaggat
gccagcaacaagctgccctgcaactgtggcgccaagcgctgccgtcgcttccttaactga

DBGET integrated database retrieval system