KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730089Help
Entry
103730089         CDS       T03372                                 

Gene name
Setdb1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
Lysine degradation
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:ngi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103730089 (Setdb1)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103730089 (Setdb1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103730089 (Setdb1)
Chromosome [BR:ngi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103730089 (Setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103730089 (Setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1288 aa AA seqDB search
MSSLPGCINLDAATAAVESEEIAELQKAVVEELGISMEELRQLIDEELEKMDCIQQRKKQ
LAELETWVLQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYHDSSSDDEAFQPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLGQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGLGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDSSCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKPMVSSQPIAPPALPDPPLSPQAGDNESLESQLA
QSRKQVAKKSTSFRPGSVGSGHSSPASPTLSENVPGGKPGIGQTYRSPLASTPAAPAPAA
PPGVLAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRSEQYRGKNPLL
VPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCLD
PYVLVDRKFQPFKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINT
GPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQVNPNSGYQYKRLEECLPTGVYEC
NKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDF
ADKEGLEMGDEYFANLDHIESVENFKEGYESDVATSSDSSGVDLKDQEDGNSGSEDPEES
NDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKESGLSEVASKDSRPPDLGPPHIPPSI
PVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSEGGDGRAGGGRGETEK
ASTSGLSIKDEGDIKQSKKEDPDDRNKISVVTESARNYGYNPSPMKPEGLRRPPSKTSMH
QSRRLVSSAQSNPDDVLTLSSSTESEGESGTSRKPTAGQTSATAVDSDDIQTISSGSEGD
DFEDKKNLSGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPIRKNTRQFYDG
EESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTW
DYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctccctgggtgcattaatttggatgcagcaacagctgcagtggaatctgaa
gagattgcagagctgcaaaaggcagtggttgaagagctgggtatctctatggaagaactt
cggcagctcattgatgaagaactggagaagatggattgtatacagcaacgcaagaagcag
ctagcagagttggagacatgggtgctacagaaagagtctgaagtggctcatgttgaccag
ctgtttgatgatgcatccagggcagtgactaattgtgagtctttggtgaaggacttctac
tctaagctgggactacagtatcatgacagtagttctgatgatgaagctttccagcctaca
gaaataattgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagcagaactccaaaagaccagaagctccgtgaagctatggctgcgttaagaaaatca
gctcaggatgtccagaagttcatggatgctgtcaacaagaagagcagttcccaggatctg
cataaaggaaccttgggtcagatgtctggagaactgagcaaagatggtgacctgatagtc
agcatgcggattctgggcaagaagagaactaagacatggcacaagggcacccttattgcc
atccagacagttggactaggaaagaaatacaaggtgaaattcgacaacaaaggaaagagt
ctgctgtcggggaaccatattgcctatgattaccaccctcctgctgacaagctgtttgtg
ggcagtcgagtggtggccaaatacaaagatggaaatcaggtctggctttatgctggcatt
gtagctgaaacaccaaacgtcaaaaacaagctcaggtttctgattttttttgatgatggc
tacgcttcctatgtcacacagtcagaactatatcccatttgccgaccactgaaaaagact
tgggaggacatagaagacagctcctgccgagatttcatagaggaatatatcactgcctac
ccaaaccgccccatggtactgctcaagagcggccaacttatcaagaccgagtgggaaggc
acgtggtggaagtcccgagttgaggaggtggatggcagcctagtcaggatcctcttcctg
gatgacaaaagatgtgaatggatctatcgaggctctacacgtttggaacccatgttcagt
atgaaaacatcctcagcctctgcactggagaagaagcaaggggggcaactcagaacccgt
ccaaatatgggtgctgtgaggagcaaaggtcctgttgtccaatacacacaggatctaacc
agcactggaacccagttcaaacccatggtatcctcacagcccattgctccaccagcccta
cctgatccacctctgtccccccaggcaggtgacaatgaaagcttggaaagccagcttgct
cagtcacggaagcaggtagccaagaagagtacatcattccggccaggatctgttggctct
ggtcattcctcccctgcatcacccacactcagtgaaaatgttcctggtgggaaacctgga
attggccagacatacagatcacctttggcctcgacaccagctgccccagcacctgcagcc
cctccaggggttctggcccccccagccttccatggcatgctagagcgggccccagctgag
ccctcctaccgcgcccccatggagaagctcttctacttgcctcatgtctgcagctataca
tgtctgtctcgggtcagacctatgaggagtgaacagtaccgaggcaagaaccctctgttg
gtcccattgctgtatgacttccggaggatgacagcccggcgccgagttaaccgcaagatg
ggctttcatgttatctataagacaccttgtggcctctgccttcggacaatgcaagaaatt
gaacgctacctttttgagactggctgtgacttccttttcttggagatgttctgtttggat
ccatatgtgcttgtagacaggaagtttcagccctttaaacctttttactatattttggac
atcacctatggcaaggaagatgttcctctgtcatgtgttaatgagattgacacaactccc
ccaccccaggtggcttacagcaaagagcgcatccctggcaagggtgttttcattaataca
ggccctgaatttctggttggctgtgactgcaaggacgggtgtcgggacaagtccaagtgt
gcctgccatcagctaaccatccaggctacagcctgcaccccagggggccaagtcaaccct
aactctggctaccagtacaagagactagaagagtgtctacccacaggggtttatgagtgt
aacaaacgctgcaaatgtgacccaaacatgtgcacaaatcggttggtacagcatggacta
caggttcgactgcagctgtttaagacgcagaacaagggctggggtattcgctgcttggat
gacatcgccaaaggctcttttgtctgtatttatgcaggaaaaatcctgacagatgacttt
gcagacaaggaaggcctggagatgggggatgagtactttgcaaatctagaccacattgag
agtgtggaaaacttcaaggaaggatatgagagtgatgtcgccacttcctctgacagcagt
ggagtagacctgaaggaccaggaagatggcaacagtggttcagaggaccctgaagaatct
aatgatgacagctcagatgacaacttctgtaaggatgaggactttagcactagctcagtg
tggcgcagctatgccacccggcgccagacccggggtcagaaggagagtggactgtccgag
gtggcttccaaggactcgcgccccccagaccttgggcccccacatatccctccctccatc
cctgtaggaggctgcaatccaccttcctctgaagagacacccaagaacaaggtggcctca
tggctgagctgcaatagtgtcagtgaaggtggttttgctgactctgacagccgatcttca
ttcaagactagtgaaggtggagatggccgggcagggggaggtcgaggggagactgagaaa
gcctccacctcaggattgagcatcaaggatgaaggtgacataaagcagtccaagaaagag
gaccctgatgaccgaaacaagatatcagtagttactgaaagcgctcgtaattatggatac
aatccttctcccatgaagcctgaagggcttcgccgcccacctagtaaaacttctatgcac
cagagccggagactggtgtcttctgcccagtcaaaccctgatgatgtcctgacactgtcc
agcagcacagaaagtgagggggaaagtggaaccagccgaaagcctactgctggtcagact
tcagccacagcagttgacagtgatgatatccagaccatctcttctggctctgaaggcgat
gactttgaggacaagaagaacttgtctggtccaatgaagcgccaggtggcagtaaaatca
acccgaggctttgctcttaaatcaacccatgggattgccattaaatcaaccaacatggct
tccgtggacaagggagagagtgcaccaattcgcaagaacacacgccaattctatgatggt
gaagagtcatgctacatcattgatgccaagcttgaaggcaacttaggccgctacctcaat
catagttgcagccccaacctgtttgtccagaatgtctttgtggatacccatgatcttcgc
ttcccctgggtggccttcttcgccagcaagaggatccgggctggaacagaacttacttgg
gactacaactacgaagtgggcagtgtggaaggcaaagagctgctgtgctgttgtggggcc
atcgagtgcagagggcgtcttctttag

DBGET integrated database retrieval system