KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730855Help
Entry
103730855         CDS       T03372                                 

Gene name
Neu4
Definition
(RefSeq) neuraminidase 4
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00511  Other glycan degradation
ngi00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ngi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    103730855 (Neu4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    103730855 (Neu4)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     103730855 (Neu4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 103730855
NCBI-ProteinID: XP_008827389
LinkDB All DBs
Position
Un
AA seq 480 aa AA seqDB search
MATRRVPKRTVLFQRERTGLTYRVPALLRVPPGPILLAFAEQRISPDDSHAHRLVVRRGM
LAGGSVRWGALRVLETAALEEHRSMNPCPVLDADSGTIFLFFIAVLGHTPEAVQIATGKN
AARLCCVTSRDAGLTWGSVRDLTEEAIGAALRDWATFAVGPGHGVQLRSGRLLIPAYTYH
VDRRECFGKVCWTSPHSLAFYSDDHGSSWHCGGLVPNLRSGECQLAAVDGGFLYCNARSP
LGNRVQALSANEGTSFLPGELVPTLAETARGCQGSIVGFPAPPSSRPQDKCWSLSPGNTS
HFQHLYPRLQESLGEGAGGPGMGWVPRGPFCYPQPWEDGLEEHGVEQGPSGDRITWTPTL
PVSSSALPQRSTWLLYSHPAGHRARLRMGIYLSQYPLDPHSWTEPWVIYEGPSGYSDLAS
LGPVPGAALAFACLFESGARASYEDISFCMFSLREVLENVPTSLELHSSRNKPQGHCWPS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccggcgtgtccccaagaggactgtgctcttccagcgggagaggacaggcctg
acctaccgggtgcctgcgctgctccgcgtgccgccagggcccattctactggccttcgct
gagcagcggatcagccctgacgactcccatgcccatcgcctggtggtgcggaggggcatg
ctggctggcggttcggtgcggtggggcgccctgcgcgtgctggagaccgcagcgctggag
gagcaccggtctatgaacccctgcccagtactggatgcagattcgggaaccatcttcctt
tttttcattgcggtcctaggccacacgcccgaggctgtgcagatcgccactggcaagaac
gcagcacgcctctgctgtgtgaccagccgcgatgcaggcctcacctggggcagtgtgcgc
gacctcacagaggaggccatcggtgcagcgctgcgggactgggctacctttgctgtgggt
ccaggccatggggtgcagcttcgctcaggacgcctgctgattcctgcttatacctaccat
gtggaccgtcgagagtgttttggcaaggtctgctggaccagtcctcactccttggccttc
tacagtgatgaccacggatcctcttggcactgtggaggccttgtgcccaacctgcgctct
ggcgagtgccaactggctgcagtggatggaggcttcctttattgtaatgcccggagcccc
ttgggcaaccgtgtgcaggcactgagtgccaacgagggcacctccttcctgcctggggaa
ctggtgcctactctggctgagactgctcgtggttgccagggcagcattgtgggcttccca
gccccaccctccagcaggcctcaggataagtgctggtcactgagccctgggaatacctca
catttccaacacctctatcccagactgcaggagtctttgggggaaggtgctggaggtcct
ggtatgggttgggtgcccagagggcctttctgttacccacagccctgggaggatggtcta
gaggagcatggcgtagagcaggggccaagtggagataggataacctggaccccaacactc
cctgtgtcctcttctgccttgccccagaggtccacttggttactgtattcccacccagca
gggcatagagctcggctccgcatgggaatctacttgagccagtaccccctggaccctcac
agctggacagagccctgggtgatctatgaaggccccagtggctactctgacctagcatcc
cttgggcctgtgcctggggcagccctggcttttgcctgtctatttgagagtggggccagg
gcttcctatgaggatatctcgttctgcatgttttcactgcgtgaggtcctggagaacgtg
cccaccagtctagagctacacagtagcaggaacaagcctcaggggcattgttggccctct
tga

DBGET integrated database retrieval system