KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103744772Help
Entry
103744772         CDS       T03372                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    103744772
   04614 Renin-angiotensin system
    103744772
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    103744772
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    103744772
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103744772
Peptidases [BR:ngi01002]
 Metallo Peptidases
  Family M2
   103744772
Exosome [BR:ngi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103744772
CD molecules [BR:ngi04090]
 Proteins
  103744772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 749 aa AA seqDB search
MKKGQTFPGPSLLVLLYYAQLLSWLRTVGEPSLDEFYNETQAKIFLQFYEQTTXVVLNQF
MEATWNYVTNTTKLNXEGMLQKEVAWSQFMVYFGTWACLFKIDQFQDPEVKRMLSKQQSI
DKSALPTKELRKYNKLLTYMETTYSTSEMCLDEGPCLPLEPDLEEIMATSRDQKEXLWAW
QGWRDAVGRQIHPVFEYYVQLSNKAAQYNGYDNLGALWHSKYESDTLEQDLEQLYEELQP
LYLNLHAYVRRSLHQYYGPEVIDLRGPIPAHLLGNMWAQSLDNILDLVLPYPEKPPEDIT
KIMKGQVRKTEPCISLFPTVSRSXHIFTSLELLPAPHDFWIKSMLERPADGRQVECHASA
WKFYKDSDVRVKKCTKYTIEDLLSIFYQIGHIQYFLQYQNLSIIFHEGASPAFEEAVGSM
ITLSAASHKYLLSKGLVSQQHQDAEEEINFLLGIALDKSVFIPFSYMIDVFRWKVFDGTI
PKNIYNQEWWNLRLKYQGLCPPVPWSEDDFDPGAKFHIPASVPYIWYFLSLVLQFQFHKT
LCRAAGHVSPLHRCDIYNSKEAGKILGDVLKLGSSRPWQEVLKEMTGEPKISSKTLLSYF
KPLLNWLVTENVKQGDILGWPDFSCSFEERNTGKVSFLGLELESDQAKIGQWLLLTLSFV
MFLVILWMGCRLHYLEKQSLDKDRMILNTLPYTYFLGIPMEPRQAAPRQWILLSFCVILT
LCSIIPIIRILTQHSRKPPWMRAAWWGLD
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagggacagactttccctggaccttccctacttgtcctcctctattatgcacag
ctcttgtcatggctcaggactgtgggagagccaagcttagatgaattctacaatgaaact
caggcaaagatattcctgcagttttatgagcaaacaacctaggttgtgctgaaccagttc
atggaagccacttggaactatgtcactaacaccaccaagctaaattgagaggggatgcta
cagaaagaggtggcgtggtcccagttcatggtgtacttcggcacctgggcctgcctgttt
aagatagaccaattccaggacccggaagtgaagcgcatgctgagtaagcagcagagcata
gacaagtcagccttgcccaccaaggagctccggaagtacaacaagcttctgacctacatg
gagacaacatacagtacgtctgagatgtgcctggatgagggcccctgcttgcccttggag
cctgacctcgaagaaatcatggccacctccagggaccagaaggagntgctgtgggcctgg
cagggctggagggatgccgtgggtcgccagatccaccctgtctttgagtactatgtgcag
ctaagcaacaaagctgcacaatataatgggtatgacaacctgggggctttgtggcattcc
aagtatgaatctgacaccctggagcaagacctggaacagctctatgaggagttacagcca
ttgtacttgaacctgcatgcctacgtgcgccgctcactgcaccaatactatggacctgaa
gtcattgacctgcgagggcccatccctgcccacctcctggggaatatgtgggctcagtcc
ttggataacatcctagatctggttctgccctaccctgaaaagccccctgaggacatcaca
aagatcatgaagggccaggtcaggaaaacagagccatgtatctctttattccccacagtt
tcaagaagctgacatatttttacctccttggagctgttgcctgccccccatgatttctgg
ataaaatcaatgttggagaggccagctgatgggcggcaagtagagtgccatgcctcagcc
tggaagttctacaaagacagtgacgtcagggtaaagaagtgcaccaaatataccatagaa
gacctgctctccatcttctaccagataggccatatccagtacttcttgcagtaccagaac
ctctctataatcttccatgaaggtgccagcccagcctttgaagaggctgtggggtccatg
atcaccctctcagctgcttcccacaagtacctgctcagcaaaggcctggtcagccaacag
caccaggatgcagaggaggagatcaacttcctgttgggcattgccttggacaagagtgtc
ttcatccccttcagctacatgatagatgtgtttcgctggaaggtctttgatggcactatt
ccaaagaacatctacaaccaggaatggtggaacctcaggttgaagtaccagggcttgtgc
ccccctgttccctggtcagaagatgactttgacccaggtgccaagttccacattcctgcc
agtgtgccctatatctggtacttcctcagcctggtgctccagttccagtttcacaaaacg
ctgtgcagggctgcaggccatgtgagccctctgcaccgatgtgatatctataactctaag
gaggcaggaaagatcctgggggatgtcctgaagctgggttcaagccgaccctggcaagaa
gtcctaaaggagatgactggagaacccaagatatcatccaagaccctcttgtcctacttc
aagccgctgctgaactggctggtgactgagaacgtgaaacagggggacatcctgggctgg
ccagatttcagctgttcttttgaagaaagaaacacaggcaaagtgtcattcttgggtttg
gaactggagtctgaccaggccaagattggacaatggctgctgctgaccctaagctttgtc
atgttcctggtgatcctgtggatgggctgcaggctgcattatttggagaaacagtcacta
gacaaggacagaatgatactcaacaccctgccctacacctacttcctgggcatacccatg
gagccccgccaggcggccccaaggcagtggatcctgctcagcttctgcgtcattctgaca
ctatgctctatcatcccaattattcggatcctcacacaacacagcaggaaacctccatgg
atgagagctgcatggtggggcttggactag

DBGET integrated database retrieval system