KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103750808Help
Entry
103750808         CDS       T03372                                 

Gene name
Ash1l
Definition
(RefSeq) ASH1 like histone lysine methyltransferase
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ngi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103750808 (Ash1l)
Enzymes [BR:ngi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103750808 (Ash1l)
Chromosome [BR:ngi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103750808 (Ash1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 2981 aa AA seqDB search
MDPRNTAMLGLGSDSEGFSRKSPSAINTGTLVSKREVEIEVNTKEEEDPRKRNREKNIEV
GKDDGLTDSQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIKQPR
KALKSGKMTDEKNEHSPSKWDPSKLYKKASDAAVIECQSEESIHLHSQGENNPLSKKLSP
VHPEMVDYINATPSLVSSRDHDIKDRTLLNGGTSVTEKLAQLIATCPPSKSSKTKPKKLG
TGTTAGLVSKDLIRKPGVGSVAGIIHKDLIKKPALSTAVGLVTKDPGKKAIFNAAVGLIN
KDSVKKLGTGTTAVFINKDLGKKPGTITTVGLLSKDSGKKLGIGIVPGLMNKESGKKLGL
GTVVGLVNKELGKKLSSTVGLVAKDCTKKIITSSAVGLVNKDIGKKLVSCSMAGLVNKDA
INLKSEALLTIQEPLKASCSTNINNHESQELSESLKDSAISKTFEKNVMRHSKESILEKF
SVRKEITNLEKEIFNEGTSIQQDSFSSSERGAFETSKHEKQPPVYCTSPDFQMGGVSDPC
TAKSPFSAVGESNLPSPSPTVSINPLTRSPPETTSQLTSNPLLLNSATEQMEEIAESVGK
NQFTSENTHLNVGHRSLSHSMSIECKGIDKELNDSKTTHLDIPRINSSLGKKPSLASESG
IHTITPSVVNFTSLFSNKPFLKLGAVTASDKHCQVAEGLSTSFQSKPLKKRKGRKPRWTK
VVARSTCRSPKGLELERSELFKNVSCSSLSNSSEPAKFMKNIGGASFVDHEFLKRRLPKL
SKSTAPSLALLTDTEKPSHKSFVAHKLSSSMCVTSDLLSDIYKPKRGRPKAQEMPQLEGP
PKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQSLSVSPFPKKRGRPKRQMRSPMK
MKPPVLSVAPFVATESPSKLESESEHHRSSSDFFESEDQLQDTDDLDDSHRQSVCNMSDL
EMEPDKKITKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHNTV
SSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQAAG
SALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFIEPSPVPYLHLHSRQ
GSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSDSG
IGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIAPETSTVLNSLKEKHKHKCKRRSHDYLSY
DKMKRQKRKRKKKYPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRI
NFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMRETMAEMPFMHSLSFPLSSTGFYPSY
GMPYSPSPLTAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPTKYHKK
KHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSEQPQVSMD
TGPSRSVLESLKRYRFGKDTVGERYKHKEKHRCHMSCPHLSPSKSLINREEQWAHREPSE
SSSLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHMNLFTSAIGSCRVSNPNSSC
RKKLTDSPGLFSAQDTALNRPHRKEPLPSSERAIQTLAGSQSTSDKPSQRPSESTNCSPT
RKRSSSESTSSMGWGSNPGTCLTWASPCKRKTKVNGIPSRSPRLVASMDDSVDSLLQRMV
QNDDQEPTEKNIDAAIATVSVPPSSSPGHNHSKERALGKPEGLLVPAVPADSCSNNAPLL
SEKLTSSCSPHHIKRSVVEAMQRQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTG
NNFVKRRPGRPRKCPLQAVVSMQAFQAAQFVNPELNEGEEGLTLHLSPDTVTDVIEAVVQ
SVNLNSEHKKGLKRKNWLLEDQTRKKHKTAPEEQQDNNKSFIETAVEMPSSLETPVKSPE
PEGTLQPVLSLIPREKKAPRPPKKKYQKAGLYSDVYKTTDPKSRLIQLKKEKLEYAPGEH
EYGLFPAPIHVGKYLRQKRIDFQLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPL
SGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLE
RFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMV
IDSYRMGNEARFINHSCDPNCEMQKWSVNGLYRIGLYALKDMPAGTELTYDYNFHSFNVE
KQQLCKCGFEKCRGIIGGKSQRMNGLTSNKSSQPMTTHKKSGRSKEKRKSKHKLKKRRGH
PSEEPSENINTPTRLTPQLQMKPMSNRERNFVLKHHVFLVRNWEKIHQKQEEVKHTSDNI
HSSSLYTRWNGICRDDGNIKSDVFMTQFSALQTARSVRTRRLAAAEENIEVARAARLAQI
FKEICDGIISYKDSSRQALAAPLLNLPPKKKNADYYEKISDPLDLITIEKQILIGYYKTV
EAFDADMLKVFRNAEKYYGRKSPIGRDVCRLRKAYYSARHEASAQIDEIVGETASEADSS
ETSVSEKENGHEKDDDVIRCICGLYKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQC
DPRPVDREVPMIPRPHYAQPGCVYFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSY
RLLSHTNRDKLDIFRIEKLWKNEKEERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYE
IIPLEAVVGTCCVLDLYTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKP
YAFDHFPKKLTPKRDFSPHYVPDNYKRNGGRSSWKSERSKPPLKDLGQEDDALPLIEEVL
ANQEQAANEIHSLEEPEQERTTAEVSEGEKKTEESSQEPQLTCTPEERRHNQRERLNQIL
LNLLEKIPGKNAIDVTYLLEEGSGRKLRRRTLFIPENSFRK
NT seq 8946 nt NT seq  +upstreamnt  +downstreamnt
atggaccctaggaatactgctatgttaggattgggttctgattccgaaggtttttcaagg
aagagtccttctgccatcaatactggcactctggtcagcaaaagagaagtagaaatagag
gttaacaccaaagaagaagaggatcctcgcaagcggaatcgagaaaaaaacattgaagta
ggaaaagacgatggtttgactgattcacagcaacagttttcagtgaaagaaacaaacttc
tcagagggaaatttaaaactgaaaattggccttcaagccaagagaactaaaaaacctcca
aagaacttggagaattacgtatgtcgacctgccataaaaacaactatcaagcaaccaagg
aaagcacttaaaagtgggaagatgacagatgaaaagaatgaacactctccttcaaagtgg
gacccttcaaagttgtacaagaaagcaagtgatgctgcagtcattgaatgccaatctgaa
gaaagcatccatcttcattcacagggagaaaataatcctttgtctaaaaagctttctcca
gtacacccagaaatggtcgattatattaatgcaacaccatctcttgttagtagtcgggat
catgatataaaggacagaacattacttaatggaggaacaagtgtaacagaaaagttggca
cagctcattgctacttgtcctccttccaagtcttccaagacaaaaccgaagaagttggga
actggcactacagcaggattggtaagcaaggacttgatcaggaaaccaggtgttggctct
gtagctggaataatacataaggacttaattaaaaagccagctcttagcacagcagttgga
ttggtaactaaagatccagggaaaaaggccatcttcaatgcagcagtaggactgatcaat
aaagactctgtgaaaaaattgggaactggcactacagcggtattcattaataaagactta
ggcaaaaagccagggactatcactacagtaggactgctgagcaaagattcaggaaagaag
ctaggaattggtattgttccaggtttaatgaataaagaatcgggcaagaaattaggactt
ggcactgtagttggactggttaataaggagctgggaaagaaattgagttctactgttggg
ctagtggccaaggactgtactaagaagattataacaagttcagctgtgggattggttaat
aaggacattggaaagaaactagtgagttgttctatggcaggactagtcaataaagatgcc
ataaaccttaaatctgaagcactgctcaccattcaggaaccacttaaggcttcttgtagt
acaaacattaataatcatgaaagtcaagaactttctgaatctctgaaagacagtgctatc
agcaaaacgtttgagaagaatgttatgcgacatagtaaagaaagcatattggaaaaattt
tcagtccgaaaagaaattactaatttggagaaagagatatttaatgaaggaacaagcatt
cagcaagacagtttctcatccagtgaaaggggagcctttgaaacctcaaaacatgaaaag
caacctcctgtatattgcacttctccagactttcaaatgggaggtgtttctgatccatgt
acagctaagtctccttttagtgcagtaggagaaagcaatcttccttctccatcacctact
gtatctattaatcctttaaccagaagtccccctgaaacaacttcacagttgacttcaaat
ccattacttttaaattctgcaacagaacaaatggaagaaattgctgaatctgttggaaag
aaccagtttacttctgaaaatacccacttaaatgttggtcataggtcattgagtcatagc
atgagtattgaatgtaaaggaattgataaagagctaaatgattcaaaaactacacatcta
gatattcctagaataaattcctccttgggaaaaaagccaagcttggcttctgaatctggt
attcatacaattactccttcagttgttaatttcactagtttatttagtaacaaacctttt
ctaaaacttggtgcagtaactgcatctgataaacactgccaagttgctgaaggcctaagt
actagtttccagtccaaaccattaaaaaaaagaaagggaagaaaacctcggtggactaaa
gtggtggcaagaagcacatgccggtctccaaaaggactagaattagaaagatcagagctt
tttaaaaatgtttcatgtagctcactatcaaatagttctgagccagctaagtttatgaaa
aacattggaggagcatcttttgttgatcatgagttccttaaacgtcgattgccaaagctg
agtaagtctacagctccatctcttgctctcctaactgacactgaaaaaccatctcataag
tcttttgttgctcacaaactgtcctccagtatgtgtgtcactagtgaccttttgtcagat
atttataagcccaaaagaggaagacctaaagcccaggaaatgcctcagctagaaggtcca
cctaaacggactttaaaaatacctgcctctaaagttttttctttgcagtctaaggaagaa
caagaacccccaattttgcagccagaaattgaaattccttccttcaaacaaagtttgtct
gtatctccttttccaaaaaagagaggtaggcctaagagacagatgaggtctccaatgaag
atgaagccacctgtattatcagtagctccatttgttgccactgaaagtccaagcaagttg
gagtctgaaagtgaacaccatagaagtagcagtgatttctttgagagtgaagatcaactt
caggatacagatgacttagatgacagtcataggcagagtgtctgtaatatgagtgacctt
gaaatggaaccagataaaaaaattaccaagagaaacaatggacaattgatgaagacaatt
atccgcaaaataaataaaatgaagactttaaagagaaagaagctgttgaatcagattctt
tcaagttctgtagaatcaagtaataaagggaaagtgcaatccaaacttcataatacagtg
tcaagtcttgctgctacatttggttctaaattgggccaacaaataaatgtcagcaagaaa
ggaaccatttatataggaaaaagaaggggtcgaaaaccaaaaactgtcttaaatggcatt
ctgtctggtagccctaccagccttgctgttcttgagcaaacagctcagcaggcagctggg
tcagcattaggacagatccttccccctttactgccctcatctgctagtagttctgagatt
cttccatcacctatttgctctcagtcttctgggactagtggaggtcagagccctgtaagt
agtgatgcaggttttattgaacctagtccagtgccatatttgcatttgcactccagacag
ggcagtatgattcagactcttgcaatgaagaaagcatcaaaggggaggaggcgattatct
cctcctactttgttgccaaattctccttcacacttgagtgaattgacttccctgaaagaa
gctactccttccccaattagtgagtctcatagtgatgagaccattcccagtgatagtggc
attggaacagacaataacagcacatcagacagggcagagaaattttgtggacaaaaaaag
aggaggcattcttttgaacatgtttctctgattgcccctgaaacctctacagtcctaaac
agtcttaaagaaaaacataaacacaaatgtaagcgcaggagtcatgattacctcagttat
gacaagatgaaaagacaaaaacgaaaacggaaaaagaaatatccacaacttcgaaatagg
caggatccagactttattgcagaactagaggaactaataagtcgtctaagtgaaattcgg
attacccatcgaagtcatcattttattccccgagacctcctgccaactatttttagaata
aactttaatagtttctatacacacccttcttttcccttagaccctttgcactacattcga
aaacctgacttaaaaaagaaaagagggaggccccctaaaatgagagagacaatggctgaa
atgccttttatgcacagtcttagttttcctctttctagtactggattctatccctcttat
ggcatgccttattctccttcaccccttacagctgctcccataggattaggttattatgga
aggtaccctcctactctttatccacctcctccttctccttcattcaccactccactgcca
cctccttcctatatgcatgctggtcatttacttcttaatcctacgaaataccataagaaa
aagcataagctgcttagacaggaggcctttcttacaaccagcaggactcctctcctttcc
atgagtacctaccccagtgtgcctcctgagatggcttatggttggatggtggagcacaaa
cacagacaccgtcacaaacatagagaacaccgttctgaacagccccaggtttccatggac
actggcccttccagatctgtcttggagtctttgaaacgttatcgatttggaaaagatact
gttggagagcgatataagcataaagaaaagcacaggtgtcacatgtcctgccctcatctc
tctccttcaaagagtttaataaacagagaagagcagtgggcccatcgagagccttcagaa
tcaagttcattagccttgggattgcaaacacctttacaaattgactgctcagaaagttct
ccaagtttatcccttggaggattcactcccaactctgagcctgccagcagtgatgaacat
atgaaccttttcacaagtgcaataggcagctgcagagtttcaaaccctaactccagttgc
cggaagaaattaactgacagtcctggactcttttctgcacaagatactgcacttaatcgg
ccacacagaaaggaaccactcccttccagtgaaagagcaatacagactttggcaggttcc
cagtcaacttcagataaaccctcccagcgaccatcagagagcacaaactgtagccctacc
cggaaaaggtcttcatctgagagtacttcttcaatgggctggggatcaaatccaggaact
tgcctaacatgggcaagtccctgcaaaagaaagacaaaagtgaatggaattccttcacga
agtcccagattggttgcttctatggatgactctgtggatagtctgctgcaacggatggta
caaaatgatgaccaagagcccacggagaaaaatattgatgctgcaattgcaactgtgtct
gtaccaccttcctccagtccaggccataaccatagtaaagaacgagccctaggcaaacca
gagggtcttctagtgccagcagtcccagctgactcttgtagtaataatgctccactcctt
tctgaaaaattaacaagcagctgttctccccatcacattaagagaagtgtagttgaagct
atgcagcgccaagctcggaaaatgtgcaattatgacaaaattttagctaccaagaaaaac
ctggaccatgtcaataaaattttaaaagccaaaaaacttcaaaggcaggccaggacaggg
aataactttgtgaagcgcagaccaggtcgacctcgaaaatgtcccctccaggctgtggta
tcaatgcaagcattccaggctgcccagtttgtcaacccagaactgaatgaaggtgaagaa
ggattaacattgcatctaagtccagatacagttactgatgtgattgaggctgtggttcag
agtgtgaaccttaattcagaacacaagaagggattgaagaggaagaattggctattagaa
gatcagaccaggaaaaagcacaagacagcaccagaggaacaacaagacaacaataaaagc
tttatagaaacagcagttgaaatgcccagttctcttgaaaccccagtaaaatctcctgaa
cctgaaggtactttgcaacctgtgctctctctcattccaagagaaaagaaagccccgcgt
cctccaaagaaaaagtaccagaaagccgggctgtattctgatgtttacaaaactacagac
ccaaagagccgattaatccaattaaagaaagagaagctggaatatgctccaggagagcat
gaatatggattattcccagcacccattcatgttggaaagtatctaagacagaagagaatt
gatttccagcttccctatgatatcctctggcagtggaaacacaatcagctatacaaaaag
ccagatgtcccactatataaaaaaattcgttcaaatgtctacgttgatgtcaaacctctt
tctggctatgaggctactacctgtaactgtaagaaaccagatgatgacaccaggaagggc
tgtgtggatgactgcctcaatagaatgatctttgctgagtgttcccctaatacttgccct
tgtggtgagcagtgctgtaaccagaggatacagaggcatgagtgggtacaatgtctggaa
cgatttcgagctgaggaaaaaggttggggaatcagaaccaaagaacccctaaaagctggt
cagttcatcattgaataccttggggaagttgtcagcgaacaggaattcaggaacaggatg
attgaacagtatcataatcacagtgaccactactgtctaaacctggatagcgggatggtg
attgacagttaccgaatgggaaatgaggccaggttcattaaccacagctgtgacccaaat
tgtgaaatgcagaaatggtctgttaacggactgtaccgtattggactgtatgcacttaaa
gatatgccagctgggactgaacttacttatgattataactttcattccttcaacgttgaa
aaacaacaactttgtaaatgtggctttgagaagtgcagaggaatcatcggaggcaaaagt
caacgaatgaatggactcaccagcaacaaaagcagtcagcctatgaccacacataaaaaa
tctggacggtctaaagagaagagaaagtctaagcacaagctgaagaaaaggagaggccat
ccttctgaagaacccagtgaaaacatcaataccccaacaagactgactccccagttacag
atgaagccaatgtccaatcgagagaggaactttgtattaaagcatcatgtgttcttggtc
cggaactgggaaaagattcatcaaaaacaggaggaagtaaagcacaccagtgataatatt
cattcttcatcattgtacacccgctggaatggtatctgccgagatgatgggaatatcaag
tctgatgtcttcatgacccagttctctgccctacagacagctagatctgttcgaacaaga
cggttggcagctgcagaggaaaacattgaagtggctcgggcagcacgcctagcccagata
ttcaaagagatctgtgatggcatcatctcttacaaagattcttcccggcaagcacttgca
gctccacttttgaatctaccccccaaaaaaaagaatgctgattattatgagaagatctct
gatcccttagatctcatcaccatagaaaagcagatcctcattggttattataagacagtg
gaagcttttgatgcagatatgctcaaggtctttcggaatgctgagaagtactatgggcgt
aaatccccaattggtagagatgtttgccgcttgcggaaggcctattacagtgcccggcat
gaggcatcagcccaaattgatgagattgtgggtgaaacagcaagtgaagcagacagcagt
gagacctctgtctctgagaaagagaatgggcatgagaaggacgatgatgttatccgctgt
atctgtggcctctacaaggatgaaggcctcatgatccagtgtgacaagtgcatggtgtgg
cagcactgtgactgtatgggagtaaactcagatgtggaacactacctttgtgagcagtgt
gacccacggcctgtggacagggaggtacccatgatcccacggccccactatgcccaacct
ggctgtgtctacttcatctgtttgctccgagatgacttgctgcttcgtcagggtgattgt
gtgtatttgatgagggatagtcggcgtacccctgatggccacccagtccgtcagtcctat
aggctgttatctcatactaaccgagataagcttgacatctttcgaattgagaagctttgg
aagaatgaaaaagaagaacggtttgcctttggtcaccattatttccgtccccatgaaacc
catcattctccatcccgccggttctatcacaatgaactatttcgggtgccactttatgag
atcattcccttggaggctgtagttggaacctgctgtgtgttggacctttatacatattgt
aaagggagacccaaaggagtgaaggaacaagatgtatacatctgtgattatcggcttgac
aagtcagcacacttattttacaagatacaccggaaccgctatcctgtctgcactaaaccc
tatgcctttgatcatttccccaagaagcttactcccaaaagagatttctcacctcattat
gtcccagacaactacaagaggaacggagggcgatcatcctggaagtctgaacgctcaaag
ccacccctaaaagatctagggcaagaagatgatgctttgcccttgattgaagaggtacta
gccaatcaggaacaagcagccaatgaaattcacagtcttgaggagccagaacaggagagg
accactgctgaagtcagtgagggtgaaaaaaaaacagaggaaagtagtcaagaaccccag
ttaacctgcacacctgaagaacgaaggcataaccagcgggagcgactcaaccagatcttg
ctcaatctccttgagaaaatccctggaaaaaatgccattgatgtgacctacttgctggaa
gaaggatcaggcaggaaactgcgaaggcgtactttgtttattccagaaaacagctttcgg
aagtga

DBGET integrated database retrieval system