KEGG   Neisseria gonorrhoeae NCCP11945: NGK_0882Help
Entry
NGK_0882          CDS       T00728                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NGK_0882
  Amino acid metabolism
   00310 Lysine degradation
    NGK_0882
   00380 Tryptophan metabolism
    NGK_0882
Enzymes [BR:ngk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NGK_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
714911..717823
Genome map
AA seq 970 aa AA seqDB search
MSFQTASVQPSGRGLLPFVYILKKRAHAMMDEKLNFSYLFGSNAPYIEELYEAFLENPDA
VDEKWKQYFTDLSKQPGTVAVDVAHTPIRESFVTLAKKKIASAVAGGADEAMLKKQVSVL
RLISAYRIQGVGAAQLDPLKRIPPRDIEALDPKFHGLSDADMALRFNMGEGDFANRGKLP
LSQIISNLKQTYCGHIALEYIYIPNTEERRWVRNYFESVLSTPHYNADQKRRILKEMTAA
ETLERYLHTKYVGQKRFGVEGGESAIAGLNYLIQNAGKDGVEEVIIGMAHRGRLNVLVNI
LGKKPGDLFAEFEGRAEIKLPSGDVKYHMGFSSDIATPHGPMHVSLAFNPSHLEIVNPVV
EGSARAKQKRLGENGRDKVLPVLIHGDSAFIGLGVNQATFNLSKTRGYTTGGTVHIVINN
QIGFTTSDIRDTRSTVHCTDIAKMVSAPVIHVNGDDPERVCFAIQAALDYRKKFHKDIVI
DVVCYRKWGHNEGDDPTLTQPMMYKKVSQHPGARALYTEQLIAEGVVTQVEADGYIQAYR
DALDKGEHVEQTTLSNFQRTQIDWSKYQGKDWREKIETGLPAADIERLTEKFTAVPEGFA
LHPTAKRVIEARKAMASGKQAIDWGMAETLAYASLLTKGHGVRISGEDSGRGTFSHRHAV
LHDQKREKWDDGTYVPLRNMGEGLGEFLVIDSILNEEAVMAFEYGFACSAPDKLTIWEAQ
FGDFANGAQVTIDQFLSSGETKWGRLCGLTTILPHGYDGQGPEHSSARVERWLQLCSENN
MQVIMPSEASQMFHLLQRQVLGSYRKPLVIFMSKRLLRFKGAMSPLENFTEGSTFRPVIG
DTAERASNDSVKRVVLCAGQVYYDLEAGRAERKLEDDVAIVRVEQLYPFPYDEVKAELAK
YPNAKSVVWAQEEPKNQGAFYQIRHRIEDVISEEQKLSYAGRPSSASPAVGYSSKHIAQL
KQLVEDALAL
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttcagacggcatcagttcagccgtcaggacgcggacttctaccctttgtttat
attttaaagaaaagagcgcacgccatgatggacgaaaaactcaatttctcttatctgttc
ggttcgaacgcaccctacattgaggaattgtacgaggcttttttggaaaaccccgatgcg
gttgatgaaaaatggaagcagtatttcaccgatttgagcaaacagccggggacggttgct
gtcgatgtcgcacacacaccgattcgcgaatcatttgttactttggcgaaaaagaaaatt
gcatctgccgttgcgggcggtgcggatgaggcaatgctgaaaaagcaagtcagcgtttta
cggctgatttctgcctatcgtatccaaggcgtgggtgcggcccaacttgatccgctcaaa
cgtatccctccgcgcgatattgaagccctcgatccgaaattccacggtctgtcagatgcc
gatatggcgcttcgattcaatatgggcgagggtgattttgccaatcgcggcaaactgccc
ttgtcccaaatcatcagcaacctcaaacaaacctactgcggccacatcgcattggaatat
atctatattcccaataccgaagagcgccgttgggtacgcaactattttgaaagcgtattg
tccacaccgcattacaatgccgatcaaaaacgccgtatcttgaaagagatgaccgctgcc
gagactttggaacgttatctgcataccaaatatgtcggtcagaaacgtttcggtgtcgaa
ggcggcgaaagcgcgattgccggtttgaactacctgattcaaaacgccggtaaggacggc
gtggaagaagtcatcatcggtatggcgcaccgtggccgtctgaatgttttggtgaacatt
ttgggcaaaaaacccggcgatttgtttgccgaatttgaaggccgtgccgaaatcaaactg
cctagtggcgacgtgaaataccatatgggcttcagctccgatattgccacccctcacggc
ccgatgcacgtttctttggcgttcaacccgtcacacttggaaatcgtcaatccggtagtg
gaaggttctgcacgcgccaaacaaaaacgtttgggcgaaaacggccgcgataaagtcttg
ccggtattgattcacggcgattccgcatttatcggtttgggtgtcaaccaagcaacattc
aacctgtctaaaacgcgcggttataccacaggcggtacggtccatatcgtcatcaacaac
caaatcggctttaccacttccgatatccgcgatacccgttcaaccgtacactgtaccgat
atcgcaaaaatggtttccgctccggttatccatgtgaacggcgatgatcccgaacgcgtt
tgctttgccattcaagccgctttggattaccgcaaaaaattccataaagacatcgtaatc
gacgttgtctgctaccgtaaatggggtcacaacgagggcgatgatccgactttgacccaa
ccgatgatgtacaaaaaagtatcgcaacatccgggtgcgcgtgctttgtacaccgagcaa
ctgattgccgaaggcgtggtaactcaagttgaggccgacggttacatccaagcctaccgt
gatgctttggacaaaggcgaacatgttgagcaaacaacgttgagcaacttccaacgcaca
caaatcgactggagcaaataccaaggtaaagattggcgcgaaaaaatcgaaaccggtttg
cctgccgccgacattgagcgtcttactgagaaattcaccgctgtgccggaaggctttgcc
ctgcatccgactgcaaaacgtgtgatcgaagcgcgtaaagccatggcatccggcaaacaa
gccatcgactggggtatggccgaaaccctcgcatacgcaagcctgctgaccaaaggtcat
ggcgtgcgtatctccggtgaggactccggccgcggtacattctcacaccgtcatgccgtt
ctgcacgatcaaaaacgcgaaaaatgggacgacggtacttatgttcctcttcgcaacatg
ggcgaaggcttgggcgagttcctggttatcgactctatcttgaacgaagaagccgtgatg
gcgttcgagtacggctttgcctgctccgctcctgacaagctgaccatttgggaagctcaa
ttcggtgacttcgccaacggcgcgcaagtaactattgatcaattcctgtcttcaggcgaa
accaagtggggtcgcttgtgcggtctgaccaccatcctgccgcacggctacgacggtcaa
ggccctgaacactcttctgcacgcgtagaacgttggttgcaactgtgttctgagaacaat
atgcaagtcatcatgccgtctgaagcgtcgcaaatgttccatctcttgcaacgccaagtc
ttgggttcataccgcaaaccgctggtgattttcatgtccaaacgcctgttgcgcttcaaa
ggtgcaatgagcccgctggaaaacttcaccgaaggttcgactttccgtccggttattggt
gataccgccgaacgcgcaagcaacgacagcgtgaaacgcgtggtattgtgtgccggtcag
gtttactatgacttggaagccggtcgagccgaacgtaaactggaagatgatgtcgctatc
gtccgcgttgagcagctgtatccgttcccatacgacgaggttaaagccgaactggcgaaa
tatccgaacgcaaaatctgtggtttgggcgcaagaagagccgaaaaaccaaggcgcgttc
taccaaatccgccaccgcatcgaagacgttatcagcgaagagcaaaaactgtcttatgcc
ggccgtccaagcagcgcatcgcctgcagtgggctactcaagcaaacacattgctcaattg
aaacaattggttgaagacgctttggcgttataa

DBGET integrated database retrieval system