KEGG   Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141: RG1141_CH01980Help
Entry
RG1141_CH01980    CDS       T03208                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ngl  Neorhizobium galegae bv. officinalis bv. officinalis HAMBI 1141
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RG1141_CH01980
Enzymes [BR:ngl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RG1141_CH01980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(180446..181960)
Genome map
AA seq 504 aa AA seqDB search
MGEEIHDIFVIGGGINGCGIARDAAGRGYSVALAEMDDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMERETLWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PPTAVLDMRTDPAGKPLKPLFTKAFEYSDGWVDDARMVVLNARDAADRGALILPRTRVVA
ARREGGLWMIETVGARTGRTETYKARMLVNAAGPWVDQVIREALGDNDARHVRLVQGSHI
VVKKKFEGSRAYFFQNRDNRIIFAIPYENDFTLIGTTDRDYSGNPRDVKISEEETTYLCN
AASEYFREPVRPADIVWTYSAVRPLFDDGASKAQEATRDYVLKLDDTQGAPLLNVFGGKL
TTYRRLSEHALEKIAEAIGAKGRPWTAKSHLPGGDFAVQGYEEEVAKLKARYPFLEERHA
RRLVRRYGTRAGMILDRATKMEDLGHHFGGDLYEAEVKYLIDREWAMSAQDVLWRRTKDG
LRLSETEKEYLEEYMAAIPAKMAG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggaaatccacgatatcttcgtgatcggcggcggcatcaatggctgcggcatt
gcacgtgatgcggccgggcgcggttattccgtggcacttgcggagatggacgattttgcc
tcgggcacctcttctggtgccaccaaactcatccatggcggcctgcgttatctcgaacat
tacgaattcaggctggtgcgggaatcgctgatggagcgcgaaaccctctgggcgatggca
ccgcatatcatctggccgctgcgcttcgtcctgccataccacaagggcggtatccgcccg
gcttggctgatccggctcggcctgtttctctacgatcatctcggcggtcgaaagctgctg
ccgccgacggccgtgctcgacatgcgtaccgatccggccggaaagcctctgaagccgctt
tttaccaaggcattcgaatattccgacggctgggtcgacgatgcccggatggtggtgctg
aacgctcgggatgcggccgatcgcggcgctctgatcctgccgcgcacccgcgtggttgcc
gcccgtcgggaaggcggcctctggatgatcgagaccgtcggcgcccgcacgggaaggaca
gagacctacaaggcccgcatgctggtgaatgccgcaggtccctgggtggatcaggtaatc
cgcgaagcgctcggcgacaatgacgcccgccatgtccgccttgtccagggcagccatatc
gtggtgaaaaagaagttcgaaggatcccgggcctatttctttcagaaccgagacaatcgc
atcattttcgcgatcccttacgaaaacgacttcacccttatcggtacgaccgaccgggac
tattccggcaatccgagagacgtgaaaatctccgaagaggagacgacctatctctgcaat
gcagcgagcgagtattttcgggagccggtgcggccggcggacatcgtctggacctattcg
gcggttcgcccgcttttcgacgacggtgcctcaaaggcgcaggaagcaacgcgcgactat
gtgctgaagctcgacgacacccagggcgcgccgttgctcaacgtgttcggcggcaagctg
accacctatcgccggctttctgaacatgcgctcgagaagatcgccgaagcgatcggagca
aaaggccggccttggacggcgaaaagccacctgccgggcggcgattttgcggtccagggt
tacgaggaagaagtagcgaaactcaaggcccgttatccatttctggaggaacggcatgcg
cggcgactggtgcgccggtatggaacccgcgccgggatgatcctcgacagggcgaccaag
atggaggatcttggtcaccacttcggcggcgatctctacgaggccgaggtcaaatatctt
atcgaccgtgaatgggccatgagtgcgcaggacgtgctctggaggagaaccaaggacggt
ttgcggctaagcgaaactgagaaagagtatctggaggagtacatggccgctataccggca
aaaatggccggataa

DBGET integrated database retrieval system