KEGG   Nocardiopsis gilva: CDO52_08995Help
Entry
CDO52_08995       CDS       T05022                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ngv  Nocardiopsis gilva
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ngv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CDO52_08995
   00650 Butanoate metabolism
    CDO52_08995
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CDO52_08995
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDO52_08995
Enzymes [BR:ngv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CDO52_08995
Amino acid related enzymes [BR:ngv01007]
 Aminotransferase (transaminase)
  Class III
   CDO52_08995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1911592..1912890
Genome map
AA seq 432 aa AA seqDB search
MSELLARHRAVMPSWLSLYYETPIEITSGSGSRVTDAEGRTYLDFFCGIVTNMLGYDIAE
VREAVERQIATGVVHTSTLYLLRGQVELAEKIARLSGIPDAKVFFTNSGTEANETALLLA
TCARGTDQVLALRNSYHGRSYGTVAVTGNRGWKNSSLSPLNVHYLHGTDQAAPAFRGMSD
AEYIDACVADLRDVLVTATAPDVACMIAEPIQGVGGFAMAPEGLLAAYKEVLDEHGILFI
ADEVQTGWGRTGSSFFGIGNHGVTPDVMTFAKGLGNGFAVGGVVARGDLMDGLTAKGVAT
FGGNPVSMAAANATLDYVLDHDLQGNAARRGALIMEGLRPLTDLSSVADVRGKGLMFAIE
MVDPVSGAPAPALAGAVLEGARERGLLVGQGGVHNNVLRMAPPLTLNEEDAREGRDILID
TVTAVDTKVRSA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaacttctcgctcgtcaccgcgctgtcatgccgtcctggctgtccctctactac
gagacgcccatcgagatcaccagcggctcggggtcccgcgtcaccgacgccgaaggccgc
acctacctggacttcttctgcggaatcgtgaccaacatgctcggctacgacatcgccgag
gtccgcgaggccgtggagcgccagatcgccacgggtgtcgtgcacacttccaccctctac
ctgctgcgcggccaggtcgagctggccgagaagatcgcccgcctctccggtatccccgac
gcgaaggtgttcttcaccaactccggtacggaggcgaacgagaccgcactgttgctcgcc
acctgcgcccgcggcaccgaccaggtgctcgcgctgcgcaacagctaccacggccggtcg
tacggcaccgtcgccgtcaccggcaaccggggctggaagaactcctcgctctccccgctc
aacgtgcactacctgcacggcaccgaccaggccgcccccgcgttccgcgggatgtcggac
gccgagtacatcgacgcctgcgtcgccgacctgcgcgatgtcctcgtcaccgccaccgcc
cccgatgtcgcctgcatgatcgccgaaccgatccagggcgtcggggggttcgccatggcc
cctgaggggctgctcgccgcgtacaaggaggttctggacgagcacggcatcctgttcatc
gccgacgaggtccagaccgggtggggccgcaccggctccagcttcttcggcatcggcaac
cacggggtgacccccgacgtcatgacgttcgccaagggtctgggcaacgggttcgcggtc
ggcggcgtggtggcgcgcggcgacctgatggacgggctcacggccaagggggtcgccacc
ttcggcggcaaccccgtatccatggcggcggccaacgccaccctcgactacgtcctcgac
cacgacctgcagggcaacgccgctcgcaggggcgcgctcatcatggaggggctgcgcccg
ctcaccgacctgtccagcgtcgccgatgtgcgcggcaagggcctgatgttcgccatcgag
atggtcgacccggtcagcggcgcgcccgctcccgcgctggccggcgccgtgctggagggc
gcccgcgagcgcggcctgctcgtcgggcagggcggggtgcacaacaacgtcctgcgcatg
gcgccgccgctgacgctgaacgaggaggacgcccgcgaagggcgggacatcctcatcgac
accgtcaccgcggtggacaccaaggtgcgcagcgcctga

DBGET integrated database retrieval system