KEGG   Nocardiopsis gilva: CDO52_16525Help
Entry
CDO52_16525       CDS       T05022                                 

Definition
(GenBank) hypothetical protein
Organism
ngv  Nocardiopsis gilva
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3623045..3624790
Genome map
AA seq 581 aa AA seqDB search
MLASTTLYDLCRNRAETRPETTAFGFLSEGDITADITYQGLDAAARVIAAGLRPLAQPGD
RALLLYEPGLDFITAFYGCLYAGLIPAPVPPPNTRKTGQAVARIAAIAASAGTSLLLSTS
GLLARLAVPLGADSGAHATAITPLATDRLTADPDDWRPPRPRPEDAAYLQFSSGSTGAPK
GTVITHSAALHNLDQISRTLRLDPEQALVSWLPMHHDTGLVAGALTPLYDGFPAWLMSPL
EFIQRPASWLSAISKLSATGTVAPDFGYELCARRVNERQRADLDLSGLRLALSGAEPIRP
TTIERFSRTFEPCGFRTTAFFPCYGLAEATLLVSGGPADTGAQTLVCDTEALARHDVVPV
PPGAPGSRTLVACGPVVPGVDLVIVDPATARPCPPGRVGEIWLSGPNVGSGYYNDPERTA
ETFGATLAEAPERTYLRTGDLGFLHDGLLYITGRIKDVLIVDGRNLYAQDLELTIRESDP
ALDTHACAVFPIDDGTREEIVAVVEVDPDDGMSEDRLAKIVREAVGAEHGVQLGRVLALR
PGSIPLTSSGKVQRFACRDAVLDGTFDSARTTALTRVQEEV
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcatcaacgacgctgtatgacctgtgccggaaccgcgccgagacgcggcccgag
acgactgccttcggctttctgtccgagggcgatatcaccgcggacatcacctatcagggc
ctggacgccgccgcgcgcgtcatcgcggccggcctgcgccctctcgcacagcccggggac
cgggcgctgcttctctatgagccgggcctggacttcatcaccgccttctacggctgcctg
tatgccgggctcatccccgcgccggtccccccacccaacacccgcaagaccggccaggcg
gtcgcccggatcgccgccatcgccgcctcggccgggacctccctgctgctgtccaccagc
ggcctgctcgcacggctggccgttcccctcggcgcggacagcggtgcgcacgccaccgcc
atcaccccgctggccaccgaccggctcaccgccgaccccgacgactggcggccgccccgg
ccccgcccagaggacgccgcctacctgcagttctcctcaggatcgaccggcgcgcccaag
ggcacggtgatcacccactccgccgccctgcacaacctcgaccagatcagccgtactctc
cgcctcgacccagagcaagcgctggtcagctggttgcccatgcaccacgacaccggcctg
gtcgccggtgcgctgacacccctctacgacggcttccccgcctggctcatgtcgccgttg
gagttcatccagcggcccgcctcctggctgtcggcgatatcgaagctgtcggcgaccggc
acggtcgcccccgacttcggatacgagctgtgtgcgcgccgggtcaacgaacgccagcgc
gccgacctcgacctctccggccttcgcctggcgctgagcggcgccgaacccatccgcccc
accaccatcgagcggttctcccggaccttcgagccgtgcggattccgcaccaccgccttc
ttcccctgctacggcctggccgaggccaccctgctggtcagcggcggaccggcggatacg
ggggcgcagacgctcgtctgcgacaccgaggcgctcgcgcgccacgacgtcgtccccgtc
ccgcccggcgcgccggggtcgcgcaccctggtggcgtgcggcccggtggtccccggcgtc
gacctggtgatcgtcgaccccgccaccgcccgcccctgtcctcccggccgcgtcggggag
atctggctcagcggccccaacgtcggcagcggctactacaacgaccccgagcgcaccgcc
gagacgttcggtgccacgctcgccgaggcccccgagcgcacctatctgcgcaccggcgac
ctcggcttcctccacgacggcctgctctacatcaccggccggatcaaggacgtgctcatc
gtcgacggccgcaacctctacgcccaggacctcgaactcaccatccgcgagagcgacccg
gcgttggacacccacgcgtgcgcggtgttccccatcgacgacggcacccgcgaggagatc
gtcgccgtcgtcgaggtcgaccccgatgacgggatgagcgaggaccggctggccaagatc
gtgcgggaggcggtcggtgccgagcacggcgtgcagctcggccgcgtcctggccctgcgg
cccggcagcatccccctcacctccagcggcaaggtgcagcgtttcgcctgccgcgacgcc
gtcctcgacggcacgttcgactccgcccgcaccaccgcgctcacccgcgtccaggaggag
gtctag

DBGET integrated database retrieval system