KEGG   Nocardiopsis gilva: CDO52_19565Help
Entry
CDO52_19565       CDS       T05022                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
ngv  Nocardiopsis gilva
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngv00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    CDO52_19565 (kynU)
Enzymes [BR:ngv01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     CDO52_19565 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4359332..4360573)
Genome map
AA seq 413 aa AA seqDB search
MTQITREDCAKLDAADPLAPFRDEFVLPDGVIYLDGNSLGALPKAAPGRVADLIEREWGR
DLVKSWNTAGWWDKPRTLGAKLAPLVGAAPHEVVVGDGTSANLFKAVIAALRLAPDRRVV
VGETGNFPTDLYITQGAVELMGATERRVDPDGPELAEALAAGDVAAVLLSHVDYRTGALR
DMAGITRMVHDSGALMIWDLCHSVGAVPIELSAWGADFAVGCTYKYLNAGPGAPAFSYVA
ERHHATARQPLSGWHGHARPFDFTGDYVPVDTASRFLSGSQPLVADAALEASLDLFARVD
MRRVREKSVAMTEMFIDLTAPAGLGLVTPRDAERRGSQVALSHPDPEAGYPTVQALIARG
VIGDFRAPDVLRFGFTPLYLRYVDVFDAATALVEVVRTGEWRDPRFAERAQVT
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagatcacgcgcgaggactgcgcgaagctggacgccgccgaccccctggccccc
ttccgagacgagttcgtcctccccgacggcgtcatctacctcgacgggaactccctgggc
gcgctgcccaaggccgcgccgggacgcgtggccgacctcatcgagcgcgagtggggccgc
gacctcgtcaagagctggaacaccgccgggtggtgggacaagccccgcaccctgggcgcc
aagctcgccccgctggtgggggcggcgccgcacgaggtggtcgtgggcgacggcacctcc
gccaacctcttcaaggcggtgatcgcggcgctgcggcttgcgcccgaccgccgcgtggtg
gtgggggagaccggcaacttccccaccgacctctacatcacccagggcgccgtggaactg
atgggggccaccgagcgccgggtcgaccccgacgggccggaactggccgaggcgctggcc
gcgggcgacgtcgccgcggtcctcctcagccacgtcgactaccgcacgggcgcgctgcgc
gacatggccggaatcacgcggatggtgcacgacagcggtgccctgatgatctgggacctg
tgccacagcgtgggcgcggtgcccatcgagctctccgcgtggggcgcggacttcgccgtg
ggctgcacctacaagtacctcaacgccggtccgggcgcccccgccttcagctatgtggcc
gaacgccaccacgccaccgcccgccagcccctcagcggctggcacgggcatgcccgcccc
ttcgacttcaccggcgactacgtcccggtcgacaccgccagccgcttcctcagtggatcc
cagcccctggtcgccgacgccgcgttggaggcgagcctggacctgttcgcccgggtggac
atgcggcgggtccgcgagaagagcgtggcgatgacggagatgttcatcgacctgaccgca
ccggccggtctgggcctggtgacaccgcgcgacgcggagcggcgcggcagccaggtggcg
ctgtcccaccccgaccctgaggcggggtacccgaccgtgcaggcgctgatcgcccgtggc
gtgatcggcgacttccgcgcgcccgatgtgctgcgcttcggattcaccccgctctacctg
cgctacgtggacgtcttcgacgccgccacggcgctggtggaggtggtgcggaccggtgag
tggcgcgaccctcggttcgccgaacgggcgcaggtcacatga

DBGET integrated database retrieval system