KEGG   Nocardiopsis gilva: CDO52_24915Help
Entry
CDO52_24915       CDS       T05022                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ngv  Nocardiopsis gilva
Pathway
ngv00564  Glycerophospholipid metabolism
ngv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CDO52_24915
Enzymes [BR:ngv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CDO52_24915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ASU85608
UniProt: A0A223SBR9
LinkDB All DBs
Position
complement(5721813..5723546)
Genome map
AA seq 577 aa AA seqDB search
MTAARMGPDERAEALAHMAENELDVLVVGGGIVGAGVALDAVSRGLSVGLIEARDFASGT
SSRSSKLIHGGLRYLEQLDFELVREALTERGLLLGRLAPHLVRPVPFLFPFQKHWERGYI
GAGVTLYDILAMTGRNTRGLPPHRHLTRSGALRVFPALRRDALAGALQYWDAQVDDARYV
LTVLRTAATYGARIASRAQAVGFLREGEHVTGARVQDLETGHEIDVRAQQVVNAAGVWTD
DIQEMVGGRGQIHVSASKGIHLVVPRDRIQASTGMILRTEKSVLFVIPWGRHWIIGTTDT
PWNLDKAHPAASRADIDYVLDHVNAVLRVPLSRDDVEGVYAGLRPLLSGESDETSKLSRE
HTVAHPVPGLVLIAGGKYTTYRVMAKDAVDAVAHGLDGKIPESVTDRVPLVGADGFAALW
NQRHTIARDAGLHVSRVVHLLRRYGSMIDDLLELMRQRPDLKEPVAGSDDYLRAEIVYAA
ASEGARHLDDVLSRRTRISFETWDRGIAAAEDAAELIAEPLGWNEEQIKREVEYYRKRIE
AERAAQEQENDHEADAVQHGAPDIVPEATPKPPRART
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagcgcgcatgggaccggacgagcgggccgaggcgctcgcgcacatggccgaa
aacgagctcgacgtcctggtcgtcggcggcggcatcgtgggcgcgggcgtcgcgctggac
gcggtgtcccgcggcctttcggtcggcctgatcgaggcgcgcgacttcgcctccggtacg
tccagccggtccagcaaactgatccacggcggcctgcgctacctcgaacagctcgacttc
gagctggtccgcgaggcactgaccgagcgcgggctgctgctcggccgcctcgccccgcac
ctggtccggccggtgccgttcctgttcccgttccagaagcactgggagcgcggctacatc
ggggccggcgtcaccctctacgacatcctggcgatgaccggccgcaacacccgcggcctg
cccccgcaccggcacctcacccgctcgggcgcgctgcgggtcttcccggcgctgcgccgc
gacgcgctcgccggtgccctccagtactgggacgcccaggtcgacgacgcccgctatgtc
ctcaccgtgctgcgcaccgccgccacctacggcgcgcggatcgcctcgcgcgcccaggcc
gtgggcttcctgcgcgagggcgagcacgtcaccggggcccgggtccaggacctggagacc
ggccacgagatcgacgtccgcgcccagcaggtggtcaacgccgccggggtgtggaccgac
gacatccaggagatggtgggcggccgcgggcagatccacgtcagcgcctccaagggcatc
cacctcgtcgtcccgagggaccggatccaggcgtcgacggggatgatcctgcgcaccgag
aaaagcgtgctgttcgtcatcccctgggggcgccactggatcatcggcaccaccgacacc
ccgtggaacctggacaaggcgcacccggcggccagccgcgccgacatcgactacgtcctc
gaccacgtcaacgccgtgctgcgggtcccgctgagccgggacgacgtcgaaggcgtctac
gccggtctgcgcccgctgctgtccggcgagtccgacgagacctccaagctctcccgggag
cacaccgtcgcccacccggtgccgggcctggtgctgatcgccgggggcaagtacaccacc
taccgcgtcatggccaaggacgcggtggacgcggtcgcccacggcctcgacggcaagatc
cccgagtcggtcaccgaccgggtgccgctcgtgggggccgacgggttcgcggcgctgtgg
aaccagcgccacaccatcgcccgcgacgccggcctgcacgtctcccgggtcgtccacctg
ctgcgcaggtacgggtcgatgatcgacgacctgctggagctgatgcgccagcgccccgac
ctcaaggagccggtggccgggtccgacgactacctgcgcgccgagatcgtgtacgcggcc
gcgtccgagggcgcccgccacctcgacgacgtgctgtcgcggcgcacccgcatctcgttc
gagacatgggaccgcggcatcgccgcggcggaggatgccgccgagctcatcgccgagccg
ctgggctggaacgaggagcagatcaagcgggaggtcgagtactaccgcaagcgcatcgag
gcggaacgcgcggcccaggagcaggagaacgaccacgaggccgacgccgtccagcacggc
gcgcccgacatcgtccccgaggccacgcccaagccgccgcgggcgcggacctaa

DBGET integrated database retrieval system