KEGG   Nitrobacter hamburgensis: Nham_3907Help
Entry
Nham_3907         CDS       T00348                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD polymerase module / ATP-dependent DNA ligase LigD phosphoesterase module
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nha  Nitrobacter hamburgensis
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nha00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Nham_3907
Enzymes [BR:nha01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Nham_3907
DNA repair and recombination proteins [BR:nha03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Nham_3907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4284719..4287421
Genome map
AA seq 900 aa AA seqDB search
MVKKLLVKYRAKRDFSKTAEPSGNLKVKPSKSLRFVIQKHAASHLHYDLRLELDGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMVWDRGYWECDDPERAY
QKGKLDFTLEGEKLHGGWILTRMRKREGEKRTNWLLIKHRDEFAREGKKNRILQEDTSVA
SSRSMDQITAGKGKGPKPFVAAKRSRAPAKAEWKPHRASARASTPRKRSAPDRSRAGRSP
EKKAGEKGNAIADRSMPPFIAPQLCSLVERPPSGSDWIHEIKFDGYRIQMRVENSDVSLK
TRKGLDWTPKFGAIAKAADALPDCIVDGEIVALDHRGSPDFAGLQAALSDGKSDDLIFFA
FDLLFLKGDDLRRQSLADRKQALKKLIEKTYGKDQVQAEIRYVEHFESGGEAVLKSACRM
SLEGIVSKQTAARYVSGRTESWSKAKCRAGHEVVIGGWKSNGNQFKSLMAGIYRGDHLVY
VGNVGTGYSAEKVARLMPRLKAAASATNPFVGNNAPRKKAGMHWLKPELVAEIEFAGFTG
AGMIRQAAFKGLRQDKPASEVEAETPAPADSAGIAKPAPALRTKSSASLPSAAKGGIVMG
VPLSRPDKILWPDDGQGPITKLDLALYYESVGARMMEHLKGRPCSIIRAPDGIEGQRFFQ
RHSMKGGSSLLEEVTVSGDRKPYVQIDRIEGLAAVAQSAGVELHPWNNQPGDPALPGRLV
FDLDPAPDVDFAVVIDAAKEMRDRLSQLGLVSFCKTTGGKGLHVVTPLARPKKGQRLDWA
AAKQFARDVCSQMARESPDRYLINMSKAKRTGKIFLDYLRNDQFSTAVAPLSPRARAHAP
VSMPITWAKVKPGLDPMQYTIRTVPQLLKKSKAWFEYCESERPLLDPIAKLARRSTKLAA
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaaaaactgctggtaaaataccgcgccaaacgcgatttttcgaagacggctgag
cccagcggaaacctaaaggtcaagccctcgaagagccttcgcttcgtcattcagaagcac
gcagcatcgcatctccattacgacctgaggctcgaactcgacggcgtcttcaaatcttgg
gcggtcaccaaggggccgtcgctggatcctcacgacaagcggcttgcggttgaagtcgag
gatcatcccctggactacggcgacttcgaaggcaccattccgaagggccagtacggcggc
ggcacggtcatggtttgggatcgcggctattgggaatgcgacgacccggagcgggcatac
cagaagggcaagctggactttaccctggagggtgaaaaacttcacggcggctggattcta
actcggatgcgaaagcgagagggcgagaagcggaccaactggctcctgatcaaacatcgg
gatgaattcgctcgggaagggaagaagaataggatcttgcaagaggacacgtcggtagcc
tcgagccggtcgatggaccagatcacggccggcaagggcaagggtccgaagccttttgtt
gcggcgaagaggtcaagagcacctgcaaaggcggaatggaaaccgcaccgcgcctcagcc
cgagcatcgacgcccagaaagagatctgctcccgacaggtcccgggccgggcgttcaccc
gaaaagaaagccggcgagaaaggcaacgcgattgccgatcgaagcatgccgcccttcatc
gcgccccagttatgctctttggtcgagcgccccccctccggcagcgattggatccacgaa
atcaagttcgacggctaccgcatccagatgcgggtcgagaacagcgacgtctccttgaag
actcgcaagggcctggattggacgccgaagttcggcgcgattgcgaaggccgcggacgca
ctgcccgattgcatcgtggacggggaaatcgttgccctcgaccatcgaggttcgccggat
ttcgcgggcttgcaggccgccctgtcggatggaaagagcgacgacctcatctttttcgcc
ttcgatcttttgtttctgaagggcgatgacctacgccggcaaagtcttgccgaccgcaag
caggccttgaagaaacttatcgagaagacatacggtaaggaccaggtccaggccgaaatc
cggtacgtcgagcatttcgagagcggtggcgaagctgtgctcaaatcggcctgcaggatg
tcgctcgagggcatcgtctcgaagcaaactgccgctcgttacgtgtccgggcgaacagag
tcctggtccaaagccaagtgtcgcgccgggcatgaagtggtcatcggcggctggaaaagc
aatggtaaccagttcaaatcgttgatggccggcatatatcggggtgatcacctcgtatac
gtcggtaacgtcgggaccggttacagtgccgagaaagtcgcgcgcctgatgccgaggctt
aaggccgccgcttcggcgacaaacccgttcgtcggcaataatgcgcctcgcaagaaagcc
ggaatgcattggttgaagcccgaattggtggccgaaatcgagttcgccggattcaccggt
gccggcatgatccggcaagcggccttcaagggccttcgccaggacaagcccgcctcggag
gtcgaagccgagacgccggcgccagctgacagcgccggcatcgcaaagcctgcaccggcg
ctgcggaccaagtcctccgcgagcctcccttccgctgcaaagggcggtattgtcatgggg
gtgcccctgagccggccggataagatcctatggcccgatgatgggcaaggaccgatcacc
aaactcgacctcgccctgtattacgaaagcgtgggcgctcggatgatggagcatctcaag
ggccgtccatgctcgataatacgagccccggacggtatcgaaggacagcgcttctttcag
cgccattcgatgaagggcggctccagcctgcttgaggaggtcaccgtctccggcgatcga
aaaccctatgtgcaaatcgaccggatcgagggtctggccgccgtggcgcagagtgccggt
gtggagttgcatccatggaacaaccagcccggcgaccccgcccttcccggccggcttgtt
ttcgatctcgacccggcgccggatgtggacttcgcggtcgtgatcgacgccgccaaggaa
atgcgcgaccgcctctcccagcttggcctcgtgtcgttctgcaagaccaccggcggcaaa
ggcttgcatgtcgttacgccgctcgcgcgcccgaaaaaaggacaacgactggactgggcc
gcagcgaagcagttcgcccgcgacgtgtgcagccaaatggcacgcgaaagtccggaccga
tacctcatcaacatgagcaaggcgaagcgaacgggaaagatatttctcgactatttgcgg
aacgatcaattctcgaccgcggtggcgccactctctccccgggcgcgcgcccatgcgccg
gtctcaatgccgatcacgtgggccaaggtcaaacctggcctcgatcccatgcaatacacc
atccgcaccgtgccccagcttctcaagaagtcgaaggcgtggttcgaatactgcgaaagt
gaacgcccgcttttggacccgatcgctaaactggcaagacggtcgacaaagctggcagct
tga

DBGET integrated database retrieval system