KEGG   Nectria haematococca: NECHADRAFT_94199Help
Entry
NECHADRAFT_94199  CDS       T01612                                 

Gene name
SDG2104
Definition
(RefSeq) SET domain protein
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
nhe  Nectria haematococca
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nhe00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    NECHADRAFT_94199 (SDG2104)
Enzymes [BR:nhe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     NECHADRAFT_94199 (SDG2104)
Chromosome [BR:nhe03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     NECHADRAFT_94199 (SDG2104)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    NECHADRAFT_94199 (SDG2104)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
6
AA seq 344 aa AA seqDB search
MEKATERHFFYHGKEGYEDERDGCHWCQIRSFATHSTIPITVVNEEDSEFLPDDFRFINN
MVLGEGVEPAGDSFRSGCSCANDGDCQYTSCLCLADLAEDESSDDEDDDPFGDRIDGMDV
DVPKVHRKAYAYHTHGSKAGLLRSKFYDSKVPIYECHQGCSCSINCPNRVVERGRTIPLQ
IFRTEDRGWGVRSPVHIKKGQFVDRYLGEIITSTEADRRRSKSAISQRKDVYLFALDKFT
DPNSYDPRLKGPPLEVDGEFMSGPTRFINHSCDPNMRIFARVGDHADKHIHDLALFAIKD
IPKGTELTFDYVDGVSNDGEEPEGDVDHMTRCLCGSKKCRKFLW
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggcaaccgagaggcacttcttctaccacggaaaagagggttacgaggatgaa
cgcgatggctgccactggtgtcagatccgctcctttgcgacacactcaaccatccccatc
acggtagtcaatgaagaagactccgagtttctgccagatgacttccgcttcatcaacaac
atggtccttggagaaggtgttgagccagctggtgatagcttccgaagcggctgctcctgc
gccaacgacggagactgccagtacacgagctgcctctgtcttgccgacctagcagaagat
gaatcaagcgatgacgaagatgacgatccatttggggaccgcattgacggcatggatgtg
gatgtgccaaaggtccatagaaaggcctacgcgtaccatacacacggttccaaagctggc
ctcctccgctccaagttctacgactccaaggtgccaatatatgaatgccatcaaggctgc
tcatgcagcattaactgcccgaaccgcgtcgttgaacgtggccgtacgattcctctgcaa
atctttcggactgaggatcgtggatggggagtgcgatcaccagtccatataaaaaaaggc
caatttgttgaccgctatctcggcgagatcatcacgtccaccgaggcagatcgccgacgg
tccaagtcagccatatctcagcgaaaggatgtctacctcttcgccctagacaaattcacc
gacccaaactcctacgatccccgcctaaaaggtccgccgctggaggttgatggcgagttc
atgtcgggcccaactcgattcatcaaccactcttgtgatcccaacatgcgaatctttgcg
cgagttggtgaccacgcagacaagcacattcacgacctggctctgttcgccatcaaggat
attccaaagggaactgaacttacgtttgactacgttgatggagtatcgaatgatggggag
gagcctgaaggtgatgtagaccacatgacgcggtgtctttgtggaagcaagaagtgcaga
aagttcctatggtga

DBGET integrated database retrieval system