KEGG   Nitrosococcus halophilus: Nhal_0493Help
Entry
Nhal_0493         CDS       T01198                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nhl  Nitrosococcus halophilus
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nhl00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Nhal_0493
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nhal_0493
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Nhal_0493
Enzymes [BR:nhl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Nhal_0493
Peptidoglycan biosynthesis and degradation proteins [BR:nhl01011]
 Precursor biosynthesis
  Amino acid ligase
   Nhal_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
505979..506929
Genome map
AA seq 316 aa AA seqDB search
MTRRMATENWGKVAVLMGGRSAEREISLKSGTAVLEALLRQGVDAQGIDVGERVLEQLSR
GQFERAFIALHGRGGEDGVIQGALETLGLPYTGSGVLGSALAMDKLRSKQLWRGMGLPTA
DFSVLNEGTDLALVVANLGLPLMVKPAREGSSLGMRKVDSIEALRAAYREAMAFDGTVIA
EQWLPGAEYTAAILTGRALPLIGLETPRIFYDFEAKYLTDTTRYLCPCGLSEEQAQHLQA
LALQAFQALGASGWGRVDFRCDAQARPCLLEVNTVPGMTAHSLVPMAAQAAGIEFDQLVL
QILESSLERSAPQDGR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaggagaatggccactgaaaattggggcaaggttgcggtgctgatgggggggcgt
tccgcggagcgggagatttctctcaagagtgggacggccgtcctggaagctctcctgagg
cagggagttgacgcccagggaatcgatgtaggtgagagggtgttagaacagctgtcaaga
ggacagtttgagcgggcctttattgcgcttcacggtcgcggcggggaagacggggttatt
caaggggctttggagactttaggtttgccctataccggtagtggagtgcttggctctgcg
cttgctatggataagcttcgcagtaagcaactttggcgggggatggggttgcctactgcg
gatttttccgtgctaaacgagggaaccgatctagcgttggtggtggccaacttaggattg
ccgctgatggttaaaccggcccgggaaggttcaagtctaggtatgaggaaggtggatagc
atcgaagcgctgagagcggcttatagggaggcgatggccttcgatgggaccgtgattgct
gagcagtggctcccaggggcagagtacacggccgctatcctaacaggacgggctttgccc
cttattggtttggaaacaccccgcatcttttatgattttgaagcgaaatacctcacggat
actacccgttatttgtgtccgtgcggattgtccgaggagcaggcgcagcacctccaggca
ttggccctacaagcctttcaggccctgggagctagtggttgggggcgagtggatttcagg
tgcgatgcacaggctcgtccctgtttacttgaggttaatacggtacccgggatgactgcc
catagtttagtgcccatggcggctcaagcggcaggtattgagtttgaccaactggtcctg
cagatattggagagcagcctggaacggagtgcgcctcaagatggccgttag

DBGET integrated database retrieval system