KEGG   Nitrosococcus halophilus: Nhal_2371Help
Entry
Nhal_2371         CDS       T01198                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
nhl  Nitrosococcus halophilus
Brite
Translation factors [BR:nhl03012]
 Eukaryotic Type
  Elongation factors
   Nhal_2371
 Prokaryotic Type
   Nhal_2371
Mitochondrial biogenesis [BR:nhl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Nhal_2371
Exosome [BR:nhl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Nhal_2371
  Exosomal proteins of breast cancer cells
   Nhal_2371
  Exosomal proteins of colorectal cancer cells
   Nhal_2371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2444499..2445689
Genome map
AA seq 396 aa AA seqDB search
MSKAKFERKKPHINVGTIGHVDHGKTTLTAALTRVLAEQYGGEFRAYDQIDNAPEERERG
ITIATAHVEYETEARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPFILVYLNKADMVDDPELLELVEMEVRELLDSYQFPGDDTPIVVGSALKALE
GDTSEIGIPSILKLVEAMDAYIPEPQRAVDQPFLMPIEDVFSISGRGTVVTGRVERGIVK
VGDEIEIVGMRETQKTTCTGVEMFRKLLDEGRAGDNVGVLLRGTKREDVERGQVLAKPGS
ITPHTKFHAEVYVLSKDEGGRHTPFFTGYRPQFYFRTTDVTGAIDLPEGVEMVMPGDNIQ
MTVSLIAPIAMEEGLRFAVREGGRTVGAGVVSKVIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggcgaaatttgagcggaagaagccgcatatcaacgtaggcacgattggtcac
gtagaccatggtaagacgacgttaacggcggcgttgacgagggtgttagcggagcaatat
ggaggggagtttagggcctatgatcagatagacaacgcgccggaggagcgggagcgaggg
attacgatagcgacggcgcacgtggaatatgagacggaggctcgccactatgcgcacgtg
gactgtcctggtcatgcggattatgtgaagaacatgattacgggtgcggcgcagatggac
ggggcgatattggtggtatcggcggcggatggtccgatgccgcagacgcgggagcatatt
ttgttggcgcgtcaggtgggggtcccgttcattttggtgtatttgaacaaggcggacatg
gtggacgacccggagctattggagcttgtggagatggaggttcgggagctgttggacagt
taccagtttccgggggatgacacaccgatagtggtgggcagtgcgttgaaggctttggaa
ggggacacgagcgagatagggattccgtcgatattgaagttagtggaggcgatggatgcg
tatattccggagccccagcgtgcggtggaccagccatttttgatgccgatagaggatgtg
ttttcgatatcgggccgggggacggtggtgacgggccgcgtggagcgagggattgtcaag
gtgggtgatgagatagagatcgtagggatgcgggagacgcagaagacgacctgtacggga
gtggagatgtttcgcaagctcttggacgagggtcgagcgggggacaatgtgggggtcttg
ttgcgggggaccaagcgcgaggatgtggagcgcgggcaggtacttgccaagccgggttcg
attacgccgcacacgaagtttcatgcggaggtgtatgttctttccaaggatgaggggggt
cggcacacgccgtttttcacggggtatcgtccgcagttttattttcggaccacggatgtg
accggcgccattgatttgcccgagggggtggagatggtgatgccgggggataatattcag
atgacggtcagtttgattgcgcccattgcgatggaggagggcttgcgttttgcggtccgc
gaaggggggcgtacggtaggggccggcgtcgtcagtaaagttattgagtaa

DBGET integrated database retrieval system