KEGG   Niabella ginsenosidivorans: A8C56_11315Help
Entry
A8C56_11315       CDS       T04418                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
nia  Niabella ginsenosidivorans
Pathway
nia00052  Galactose metabolism
nia00511  Other glycan degradation
nia00600  Sphingolipid metabolism
nia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nia00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A8C56_11315
  Lipid metabolism
   00600 Sphingolipid metabolism
    A8C56_11315
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A8C56_11315
Enzymes [BR:nia01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A8C56_11315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Big_1
Motif
Other DBs
NCBI-ProteinID: ANH81488
UniProt: A0A1A9I1F9
LinkDB All DBs
Position
2723951..2726704
Genome map
AA seq 917 aa AA seqDB search
MSPLLFKQSIYRQKIIFIITLLAVSLPAFRLCAQPPAAQPAARERICLNEGWRFMRYTKE
PDTLIYDEWPQSFDRNDNKVADTRATESAVVISSARSLKNWILPAINEFVKDPAAHYQRP
PGNPGKDFAFVQNNFDDSRWASVSLPHDWAIKGPFYKEENAIVGGGMGRLPIQGVAWYRR
KINIPESDKNKNIYLDIDGAMSYTMVWINGMLAGGWPYGYNSFRINLTPYIKPGEDNQLA
IRLDNPANSSRWYPGAGIYRNVWLVKTNRLHIAHWGTFIRTNNVSAASATVSLTAQVENT
SDANEQINTVTDIFLLNNQSQRTGNKIASFPARAININARSKTTVENTVKIKDPLLWGPP
PMQNPNLYVAVTRLYRQGKLIDEYETRFGIRELTFDADKGLIVNGRPVRIQGVNQHHDLG
AIGTAFNTRAAERQLELLKEMGCNAIRLAHNPPAPELLDLTDRMGFLVIDEVFDCWEKGK
TPLDFHLIFKDWHEADIRSFIRRDRNHPSVIAWSFGNEVGEQYTGEEGAAIAKKLHAIVK
DEDSTRPATASMNYAKPDMPFPAVMDIISLNYQGEGIRDAPAYAHLKGIKTTPLYPAFHQ
KFPGKMIVSSETASTLSTRDTYIFPVTSGISAPVSDTTGGDPQNSFVSAYDLYTAQFGAS
PDKVFAAQDHNPYVAGEFVWSGWDYLGEPTPYYTARSSYSGIIDLAGFKKDRFYLYQSRW
RPNLPMAHLLPHWTWPGRTGKITPVHVFTSGDEAELFLNGKSLGRKKKAPFEYRLRWDSI
IYEPGELKVIAYKNGKPWATDIVNTAAAPAALRLSADRDTIAVGNNDLSFITAAVTDHKG
TLVPDADNSIRFSISGPGEIVATDNGNPADMTSFSSGERNAFSGKALVIVRATGKGVIRL
TAASNNLPTASVTIRTQ
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccattactttttaaacagagcatatacagacaaaaaataatttttatcatcact
ttgctggccgtatccctgcctgcattccggctttgtgcacagccacctgcagcccagcct
gcggcacgtgagcgcatttgcctgaatgagggctggcgttttatgcgttatacaaaagag
ccggacacactgatctatgatgaatggccgcaaagctttgacaggaacgataataaggtg
gcagataccagggctacggagtcagctgttgtgatttcatcagcccggtcattaaagaac
tggatattgcccgcaatcaatgagtttgttaaggatcctgcagcacattaccagcggcca
ccaggcaaccccggtaaagactttgcgtttgttcaaaataattttgatgattcaagatgg
gcatccgtatcactgccacatgactgggccattaaagggcctttctataaagaggaaaat
gccatcgttggcggcggtatgggccggttgcccatccagggagtagcctggtatcgcaga
aaaataaatatacccgaatcagacaaaaacaaaaatatctatctggatatagacggcgcc
atgagctatactatggtatggatcaacggaatgcttgccggaggctggccttacgggtat
aattccttcaggataaatcttacaccctatattaaaccgggtgaggataaccagcttgcc
atccgcctggacaatccggcaaactcctcccgctggtatcccggcgcaggcatttaccgg
aacgtttggctggtaaaaacaaaccggctgcatatagcacattggggcacttttatccgc
acaaacaatgtatcggcagcctccgcaacagtaagcttaactgcccaggttgaaaacaca
tctgatgccaatgagcaaatcaatacggtaacagatatttttttgctgaacaaccaatca
caaagaacaggcaataagatcgcttcatttccggcccgtgcaatcaatatcaatgcccgc
agtaaaacaactgttgagaacaccgttaagataaaagatcctttactatgggggccgccg
cccatgcaaaatcccaatttatatgtagcagtgacccgtttgtaccggcaaggcaagctg
atagatgaatatgaaacccggtttggcatccgggagttaacatttgatgcagacaaagga
cttatagtgaatggccggccggtgcgcattcagggcgttaaccagcatcatgatctgggc
gcaataggcacagcctttaacacaagagcggcagaaagacagctggaactgttaaaggaa
atgggatgcaacgccatccggctggcgcataaccccccggctccggagttactggatctt
actgaccggatgggctttctggtaatagatgaagtatttgattgctgggaaaaaggtaaa
acgccgctcgattttcatctgatatttaaagactggcacgaagcagatatcaggtcgttc
ataaggcgcgaccgtaatcatccgtctgtaattgcgtggagctttggcaacgaagtaggc
gagcaatataccggggaagaaggcgctgcgatagcaaaaaaactacatgctattgtaaag
gatgaagacagcacccggcctgcaaccgcatccatgaactatgcaaagcccgatatgcct
tttccggcggttatggatatcatcagcctgaattaccagggggaaggtatccgtgatgca
ccggcctatgctcatttaaaaggaataaaaacaactccgctgtaccctgcattccatcaa
aaatttcccggcaaaatgatcgtaagcagcgaaaccgcatccacgttaagcacccgggac
acctatatttttcccgttaccagcggtatcagtgcgcccgtaagcgatactaccggtggt
gatccgcaaaacagttttgtcagtgcttatgatctctatacggcacaatttggcgcttca
ccggataaagtgtttgccgcccaggatcacaatccctatgtagccggcgaatttgtatgg
agtggctgggattacttaggggagcctaccccctattatacggcgcggagctcttattca
gggatcattgacctggcgggatttaaaaaggaccggttttatctctatcaatccagatgg
agaccaaacctgccaatggcacatcttttaccacactggacatggcccggccgcaccggg
aaaataacaccggtgcatgtatttacctctggtgacgaagctgaattatttttaaatgga
aaatcccttggcagaaaaaagaaagctccttttgaataccgcctgcgctgggacagtatt
atttatgaacccggcgaactgaaagtgattgcttataaaaacggaaagccatgggcaacg
gatattgtaaacaccgcagcagctccggctgcgctgcgtttaagcgcagacagggataca
attgctgttggaaataatgacctttcttttatcacagcagctgttaccgaccataaaggc
actttagtacctgatgctgacaacagcattcgcttctcgataagcgggcccggtgaaatt
gtagcaactgacaatgggaaccctgctgatatgacctccttttcctccggagaacggaat
gcatttagcggaaaagccctggtaattgttcgcgcaacaggaaaaggagtgatccgctta
acggcggcatccaacaacctgcccacagcatcagtaaccatcaggactcaataa

DBGET integrated database retrieval system