KEGG   Nitratiruptor sp. SB155-2: NIS_1773Help
Entry
NIS_1773          CDS       T00565                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
nis00010  Glycolysis / Gluconeogenesis
nis00230  Purine metabolism
nis00620  Pyruvate metabolism
nis01100  Metabolic pathways
nis01110  Biosynthesis of secondary metabolites
nis01120  Microbial metabolism in diverse environments
nis01130  Biosynthesis of antibiotics
nis01200  Carbon metabolism
nis01230  Biosynthesis of amino acids
Module
nis_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nis_M00002  Glycolysis, core module involving three-carbon compounds
nis_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
nis_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIS_1773
   00620 Pyruvate metabolism
    NIS_1773
  Nucleotide metabolism
   00230 Purine metabolism
    NIS_1773
Enzymes [BR:nis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     NIS_1773
Membrane trafficking [BR:nis04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NIS_1773
Exosome [BR:nis04147]
 Exosomal proteins
  Proteins found in most exosomes
   NIS_1773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI IMPDH
Motif
Other DBs
NCBI-ProteinID: BAF70878
UniProt: A6Q5W9
LinkDB All DBs
Position
1795740..1797116
Genome map
AA seq 458 aa AA seqDB search
MTKIVATIGPSSIEKIDKLILAGVNVFRLNFSHADHKTHKASIKKIRETAKKLGTKTAIL
QDISGPKIRIGEVDGILELSKGDKIRLVKTHPKSKYDLTLSYPQIIDDLEVGEYVFFADG
TIRTKVIEKDSDSVTLLVKNPGVLSSRKGVNFPHSNLRLSAITPKDEKDLRFGAKEGVDI
VAISFVNSAQDIKKARSILAQEEANPWIVAKIETKKAVENLESILQASDGVMVARGDLGI
EVGIEKVPVIQKRIIKEANRLGKPVITATQMLLSMVNSPFPTRAEVSDVANAVIDGSDAV
MLSDETTVGKYPVEAVQTLRKVIDETMSIYPFYKRYEGKDVDAIAGSVADLCRSINPKAI
VSFTSSGTTVKSIAKYRPNAPIIAVTHDKKTSHKLSLVWGVQTVLEMPKIKNPEHLIQKF
LDTALREEFLFLGDKVIITMGSIVGKEGTTNMIRVVEI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaatcgttgcgacaattggaccaagttcaattgaaaaaatagacaaactcatt
cttgccggagtcaatgtttttcggctcaacttcagtcacgccgatcacaaaacccataaa
gcatctatcaaaaaaattcgagaaacggctaagaaacttggtacaaaaacggccatttta
caagatatcagcggtcctaaaattcgaatcggcgaggttgatggcattttggaactcagc
aaaggcgacaaaattcgccttgtcaaaacacatccaaaatcaaaatatgacctgacactc
agttatccgcaaattatcgatgatctagaagttggcgagtatgtcttcttcgccgatgga
accatccggacaaaagtgatcgaaaaagatagcgacagcgttacactccttgtcaaaaat
ccaggagtcctttcaagcagaaaaggtgtcaactttccccactccaatctgcgtcttagc
gccattacaccaaaagatgagaaagatttacgatttggagccaaagagggtgtggatatc
gttgcaatcagttttgtcaacagtgctcaagatatcaaaaaagcgcgttccattctagcc
caagaggaagcaaatccatggattgttgccaagatagaaacgaaaaaagcggtggaaaac
cttgaatcgattttgcaagcaagcgatggggtcatggtggctagaggcgatcttggcata
gaggtgggcatcgaaaaggttcccgtaattcaaaaacgtatcatcaaagaggccaaccga
ttaggaaaacctgtcattactgcaacacagatgttactttctatggtcaactcccctttt
ccaacacgagcggaagtgagtgatgtggccaatgcagtgatagatggaagcgatgcggtg
atgctcagtgacgagacgactgtaggcaaatatccggttgaggcggtacagaccctacga
aaagtcatcgatgagaccatgagcatctatccattttacaaacgctatgaaggaaaagat
gtcgatgccatcgccggtagcgttgctgatctatgccgctcaataaacccaaaagcgatc
gtctcctttacaagcagcggtacaacggtcaaaagcattgcaaaatatcgccccaatgct
cctatcatcgctgttacacacgataaaaagacttcccataaactttcgctggtatgggga
gtacaaaccgttttggagatgccaaaaatcaaaaatccagagcatctcattcaaaagttt
ctcgatacagccttgagagaagagtttctctttttgggcgataaagttatcatcacgatg
gggagtatcgtagggaaagaggggaccacaaatatgattcgagtggttgagatataa

DBGET integrated database retrieval system