KEGG   Nitrosomonas sp. AL212: NAL212_0307Help
Entry
NAL212_0307       CDS       T01443                                 

Definition
(GenBank) Long-chain-fatty-acid--(acyl-carrier-protein) ligase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
nit  Nitrosomonas sp. AL212
Brite
Enzymes [BR:nit01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     NAL212_0307
Lipid biosynthesis proteins [BR:nit01004]
 Acyl-CoA synthetase
  Unknown
   NAL212_0307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
175246..177069
Genome map
AA seq 607 aa AA seqDB search
MSSTIIKLNAPLTQAFDFQPSSELHLTPTPTLNTLIQQLAGFDTLTSALEYAAKGVTGYN
FYDAKGNVRSVLPYKTLRQNARILARRLFGFDLPRGSRIAIIADTSPEFVELFFACRYAG
LVPFAMPIPVNLGSHAIYVQQLRGMLESSQASIALANIDYINFLEEAVIGATSIRWTGTP
GKLNELPIHDVELQSNHPDETAYLQFTSGSTRTPRGVVITERALMCNLQGIVRNGLEIRP
DDRSASWLPFYHDMGLVGLVLAPMVTQISVDYLATRDFAIRPLQWLRLISRNRCTVAFSQ
PFGLKLCTLRVRESDLKELDLSCWRAAGIGAEMIRPETLRNFAEKFSSAGFDENAFLPCY
GLAESTLAVTFSKINTGCNSLQVDSKTLIDKKMAVRLQADGRKQNEFVNCGRPLPGHIVK
IIGEDGHQLSEMMVGSVLVQGDSVMTGYYNNPEETNKALKPGNWLDTGDIGFLFEGDLFI
TGRRTDVIIVNGRNIRAQDIEELAEQQPEVRSREASAFGINDEDGTTTIVLVIECRLTSP
TERQSLTTRLQQLVYMAFGVNCVVELVPPHTLPRTSSGKLSRFAARQGYIQRTQLVDQLS
FVESGDR
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
ttgagttcgacaataatcaagttgaacgctccgctaacgcaagcgtttgattttcagcct
tcaagcgaattgcatctaacaccgacaccgacactcaatacgctaattcagcagttggct
ggctttgatacgctaacaagtgctttagaatatgcagcgaagggagtaacggggtataac
ttttatgacgcaaagggaaatgttcgttcagttctgccatacaaaacacttaggcagaat
gctcgtattttggctaggcgtttgttcggttttgatttgccccggggtagccggatagca
atcatcgctgatacctctccggaatttgttgagttgttttttgcatgccgctatgctggg
ctagttccatttgcaatgccgattccggttaatctcggaagccatgcaatatatgttcag
caattgaggggtatgcttgaaagtagtcaagcgagtattgcactagctaatattgattac
attaattttcttgaagaagcagtaataggtgcaaccagcattcgttggacgggaacacca
ggaaaattaaatgagcttcctatacatgatgtagaactgcagtctaatcatcccgatgaa
actgcgtatttgcaatttacatcaggtagtacgcgcaccccacgtggtgtagttataact
gaacgagccttgatgtgtaatttacaaggtattgtgcgtaatggtttggaaataagacct
gatgatcgttctgcatcgtggttgcctttttatcatgatatggggttggttgggctcgtt
ctggctccgatggttacacagatttcagtagattatttagcaactcgggattttgcaatt
cgtccattgcagtggctgcggctaattagcaggaatcgttgtacggttgcattcagccaa
ccatttggccttaagctatgtacgcttcgtgtgcgagaatctgatctaaaagaattggat
ttgagttgttggcgagcagctggtatcggcgcagaaatgattcgtcccgaaactttaaga
aactttgctgagaaattttcatcagccggttttgatgagaatgcctttttgccatgttat
ggacttgcagagtcaacacttgctgttacattttcaaaaatcaatacaggatgtaatagt
ctgcaagtagatagtaagaccctgattgataaaaaaatggcagtgagattgcaagctgat
ggtcgaaaacaaaatgaatttgtaaattgcgggcgtccattgcccgggcatatcgttaaa
ataattggcgaagatggtcatcaattatctgagatgatggttggaagcgtgctggtgcag
ggtgatagtgtaatgacgggttattataataacccagaggagacgaacaaggcacttaag
cctggaaattggttggataccggtgatatcggttttctgtttgaaggtgatttgtttata
accggacgtcgtaccgatgtgattatagttaatggtcgcaatattcgagcgcaagacatt
gaagagttggccgaacaacaaccagaagtcaggtcgcgtgaggcatctgcctttggaatt
aatgatgaagatggtacaacgactattgtattggtgattgaatgcagactcacctctcca
acagaacgtcaatcactgactaccagattgcagcagcttgtttatatggcatttggagtc
aattgtgttgttgaacttgtaccgccgcataccttgccaagaacctcatctggtaagctt
tcgcgttttgcggctagacagggatatattcaaagaactcaattagttgatcaattatct
tttgtagagtcaggcgacagataa

DBGET integrated database retrieval system