KEGG   Nitrospira japonica: NSJP_3909Help
Entry
NSJP_3909         CDS       T05001                                 

Definition
(GenBank) putative Multi-domain non-ribosomal peptide synthetase
Organism
nja  Nitrospira japonica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C PNP_phzG_C
Motif
Other DBs
NCBI-ProteinID: SLM50076
UniProt: A0A1W1IAQ1
LinkDB All DBs
Position
I:complement(3791612..3797014)
Genome map
AA seq 1800 aa AA seqDB search
MLGVCLPFGGSQVGVGQHGDKTLVDLARRRAGESPAQSAYTFLLDGETEACELTYGELDR
RARAIAAWLQSFGARDERAILLFPPGLDYIAAFIGCLYAQVVAVPAYPPLRKRTMGRLQA
VLADSGAIFALTTGKIRANIERFADQEPETLAGLSRLRWLETDAVPAAIEDQWRRPTVTG
ETLAFLQYTSGSTGSPKGVMVGHDNLLHNQHMIRQAFGHTAQTTVLGWLPLYHDMGLIGN
VLQPLYLGRPCVLMSPAHFMQRPFRWLSAISRYRATTSGAPNFAYDLCVRHVNEEERASL
DLSSWSVAFNGAEPIHPGTLDRFTETFGPCGFRREAFYPCYGLAEATLFVSGGVHGRAPM
LRNVEKAALAQARLVDSADERDAQRLVGCGISGLDQQIRIVDPDSRTVRPDGAVGEVWVK
GPSVARGYWNRRDATAQTFEAVIAESGEGPFLRTGDLGVTKDGELFVVGRLKDLIIIRGR
NHYPHDIEATVQGVHPALRAGGSAAFSVEVESDEQLVVVQELAGRAGLDVEALIADIRQA
VAEHHEIQVHAVVLIKQGTLPKTSSGKVQRRLCREKFLTDGLDTIRAVLQTGGAPAVEAH
AWGPADSVERAIAGVWAQVLGRASVGPDDDFFALGGDSLRGTQVLVRLRKIYDVDVSLES
LFDTPTVAGLAALVESRRLAELPAIKQPSGAARERRMDVMPLSYSQDRFWFLDQLSPDSP
FNNIPVALHIAGPLDVPALERAHAEIIRRHDILRSLFVLDGGRPGQRIVPPVDGVLSIDD
LSAFAGADREERLRRAMTDEARRLFDLSRGPVLRTRLLRLGESEHVLLLTVHHIAADGWS
MRVLSRELSRLYEAFLAGLPSPLPALPVQYVDTVLRQREQADGEEWKKQEHYWRRQLEGA
PHTLTLPFDFPRPAVQGQSGARHAWTIDREIGTRIDALSRTRRCSSFMTLLAAFDVLLSR
YSGQTDFCVGTPVANRGKLDSEDLIGCFVNTVAVRADLSGDPPFIELLERVRKTVLGAQA
HQDVPFERLVETLQIPRSLSHTPIYQVMMVLEDNPPDLCRLSGCDVRRMATSTGTSAFDL
ALELTAQPDGSVSAVLEYSTDLFAGDTMARMATHFDELLRQIVRRPQARLSELAMLSGDE
RAAVLVDCNRTAADYPSSHCLHHLFEEQARMRPDAVALVAEGRAYGYADVDARSNRLAAY
LRSRGLTTETRVALCVERSLEMVVGLLGVLKAGAAYVPMDPAYPGDRLAFMIRDSGAELL
LIQGRSRPAVSDCGVPVLALDEEWQSVAAAPSLAAPVSVGPDNLAYVLYTSGTTGRPKGT
AISHRSLVNHSTAMVRHYGLGPGDRVLQFASVSFDVAAEECFPSWAAGATVVLRPNEPVT
AFADLHRFILDHGLTLLNLPTPYWADWTEVMEQNGTTLPPSVRLVVVGSEKALPDNLARW
QRLVGDRIAWCNSYGPTEATVTASYFVPGEDRSWMSLAAVPIGRPISNVQLYVLDSSLQP
VPAGIAGELCIGGVGLARGYHGQPGLTADRFVPHGFSDQPGARLYRTGDRVRRRPDGNLD
FLGRGDDQIKIRGFRVEPAEIEFWSREHADVKDVRVYLESADRAGEISAPVRLVGYAVLR
EGSSLSMQQLRSFLAERLPEYMVPAVWVFLDAFPLTERGKVDREALRALVQRSPETPAAS
SPPETETEQAIAEIWKDALGVAAVGRQDNFFDLGGHSLLLAKILTSLRSLSRRPLAMLDL
FRYPTVQSLAAYLEGSGDGTDRGGAEENADLAHRAKERRTAGVRRLRRQREQRQGAKDGI
NT seq 5403 nt NT seq  +upstreamnt  +downstreamnt
atgctcggggtgtgtctaccgttcggagggagtcaggtgggggtaggtcagcacggagac
aagactctggtcgatctcgcccgccgaagagcaggcgagtcccccgcgcaatccgcgtac
acgtttctcctcgacggggagactgaagcgtgtgaactgacgtacggggaactcgatcgc
cgtgctcgcgcgatcgccgcctggctgcagtcgttcggcgcgcgggatgaacgggccatc
ctgctgttccctcccggccttgactacatcgccgcattcatcggttgcctgtatgcccag
gtggtggcggtgccggcctatccgcctctgcggaagcgaaccatgggacgcctgcaggcc
gtgctcgccgattccggagccatcttcgccctcacgaccgggaaaattcgcgcgaacatc
gaacggtttgcggaccaagaacccgagacgcttgccggcctgtcgcgtctccgatggctg
gagaccgatgcggtgccggctgccatcgaagatcaatggcggcgtccaaccgtaacgggt
gagacgcttgccttcctccaatacacctccggatcgacgggttcgccgaagggcgtgatg
gtcgggcacgacaatcttttgcacaaccagcacatgatccggcaggccttcggccatacg
gcacagacgaccgtgctgggatggctgccgctgtatcacgacatgggattgatcggaaac
gtgctgcagccgttgtatttggggcggccctgcgtcctgatgtctcccgcgcatttcatg
cagcggccgtttcgctggctgtcggccatttcccggtatcgggccacgacgagcggcgcg
ccgaatttcgcctacgacctctgcgtgcgccacgtgaatgaagaggagcgagcctcgctg
gacctcagttcctggtcggtggcgttcaacggggcggagccgattcatcccggaacgctg
gatcgtttcacggagactttcgggccgtgcggattcaggcgggaggccttttatccctgc
tacggattggccgaggccaccctgttcgtgtcgggaggagtgcacggccgtgctccgatg
ctgcgaaacgtggaaaaggcggctctcgcgcaggcccgcctggtggactccgcggacgag
cgcgacgctcagcgtctggttgggtgcggcatatcgggactggatcaacagatccgcatc
gtcgatccggatagccgtactgtccgtccggacggggcggtgggagaggtgtgggtcaag
gggccgagcgtggcgcgaggctactggaacaggcgggatgcaacagcccagaccttcgag
gccgtcatcgcggaaagcggcgaaggcccgtttcttcgaaccggcgatctcggggtgacg
aaagacggcgaactattcgtcgtcggccggttgaaagacctgatcattatccgcgggcgc
aaccactatccccacgatatcgaagcgacggttcaaggcgtgcatcctgccctgcgggcc
ggcggcagcgcggcgttttcagtcgaggttgagagtgacgagcagttggtcgtcgtgcag
gaactggctggacgagccggcctggacgtcgaagccctcatcgccgacatccgccaggcc
gtcgccgagcaccacgagatccaggttcatgcggtcgtattgatcaagcagggcacgctt
cccaagacgtccagcggaaaagtgcagcgacgtctgtgccgggagaaattcttgacggat
gggttggacacgatccgcgcggtcttgcaaaccggtggagcaccagccgtagaagcccac
gcctggggtcccgctgattccgtcgaaagggcgatcgccggggtctgggcgcaggtgctc
ggccgtgcatccgtcggaccggacgacgacttcttcgcgctgggcggagactcgttgcgc
ggcacgcaggtgttggtccgcctacggaagatctacgatgtggacgtgtcgttggagtcg
ctgttcgatactcctaccgtggccggactcgccgcactggtggagtcgcgccgcctggcc
gagcttccggcgatcaaacagccgtcgggggcggctcgggaacgccgcatggacgtgatg
ccgttgtcctattcgcaggaccggttctggtttctggatcaactgtctccggacagccca
ttcaacaacattcccgtggcgctccacatcgccggaccgctcgatgtcccggcgctcgaa
cgcgcccacgcggaaatcatccggcgccacgacatactccggtccctgttcgtattggac
ggcggacggccagggcaacgcatcgtccctccagtcgacggcgtcctttcgatcgacgat
ctctccgcgttcgcgggcgccgatagggaagaacggctcaggcgcgcgatgaccgacgag
gcgcgtcgcctgttcgatttgagccggggaccggttctgcggaccaggcttctacgactc
ggcgagtccgagcatgtcctgttgttgaccgtccatcacatcgcggccgacggctggtcc
atgcgcgtgctcagccgcgaactctcgcgcctgtacgaggcgtttctcgcaggacttccg
tcgccgctccccgcgctgccggtgcagtacgtggacacggtgctgcggcagcgggagcaa
gcggacggagaagaatggaagaagcaggagcactattggcgccgtcagctggagggagcg
ccgcacacgttgacactgccgttcgattttccgcggccggcggttcaggggcaaagcggc
gcccggcacgcatggacgatcgatcgggagatcggcacgcggatcgacgcgctcagcagg
acgcggcggtgctcgtcgttcatgaccttgctcgcggcattcgacgtgctgttgagccga
tacagcggccagaccgatttctgtgtcggaacgccggtggccaaccgcggcaaactggac
agcgaagatctcatcggctgcttcgtgaatacggttgcggtgcgcgccgatctgtccggt
gatccgccgttcatcgaattactcgagcgggtgcgcaagacggtacttggcgcgcaggca
catcaggacgttccgttcgagcgattggtcgagaccctccagataccgcgatccctcagc
catacgccgatctatcaggtgatgatggtcctcgaggacaatccgccggacctctgccgg
ttgagcggctgtgacgtccggcgaatggcgacgagtaccggcacgtcggccttcgacctg
gcgttagagttgacggcgcagccggatgggagcgtaagcgcggtccttgaatacagcacg
gacctgttcgccggcgacacgatggcccgcatggccactcactttgacgagctgctccgg
caaatcgttcggcgtcctcaggcccgtctcagcgaactcgcgatgttgtccggggacgag
cgtgctgcggtgctcgtggattgcaatcgaactgccgcggactatccaagctcgcactgt
ctccaccacctgttcgaagaacaagcgcgtatgagacccgacgccgtcgcgctggtcgca
gagggccgcgcgtacggctatgcggacgtggatgcccgctcgaaccggcttgccgcctat
ttgaggtcgcggggcctgacgacggagaccagagtcgctttgtgcgtggagcgctcgctt
gaaatggtggtgggactgctcggcgtgctcaaggcaggggccgcatatgtgccgatggat
ccagcctatcccggagaccggttggccttcatgattcgggacagcggagcggagctgctc
ctgatccagggccgcagccgccccgccgtttccgattgcggcgttcccgttttggcgttg
gatgaagaatggcagagcgtcgccgctgctccgtcgctcgccgcccccgtgtccgtgggg
cccgacaatctcgcctatgtgctctatacctccggcacgacaggcaggccgaaaggcacc
gcgatttcgcaccggtccctggtaaaccacagcacggcgatggtgcgtcactatggattg
ggcccgggcgaccgcgtgcttcagtttgcctccgtcagcttcgacgtcgcggcggaagag
tgttttcccagctgggctgccggtgccaccgtcgtattgcggccgaatgagccggtgacc
gcatttgccgatctccatcgcttcatcctggatcacggactgacgctgctcaacctgccg
accccgtactgggccgactggaccgaggtgatggagcagaatggaacgacgctcccgccg
tccgtcagattggtcgtcgtcggaagcgaaaaggcgttgccggacaacctggcccggtgg
cagcggctcgtcggcgatcggattgcctggtgcaattcgtacggtccgaccgaagcgacg
gtcaccgcgagttatttcgtcccgggtgaggatcgcagctggatgtccctggctgcggtg
ccgatcgggcgccccatctcgaatgtgcagttgtatgtcctcgattcgtctctccagccg
gttccggccggcatcgccggtgaactgtgcattggcggggttggactggcccgaggctac
cacggtcaaccggggctgactgccgatcggtttgttcctcacggcttcagcgaccagccg
ggggcgcggctgtaccgcaccggcgaccgggtccggaggcgtccggacggcaacctggat
tttctgggacgcggtgacgatcagatcaagatcaggggcttccgggtcgagccggccgaa
atcgagttctggtcccgagaacatgccgacgtcaaagacgtgcgtgtgtatctcgaatcg
gccgatcgggcgggggaaatctccgcaccggttcggcttgtcgggtatgccgtgcttcgg
gagggctcgtctctctccatgcagcagctccgttcctttctcgcggaacgtcttccggaa
tatatggtgccggcggtctgggtattcctggatgcgtttccgttgaccgaacggggcaag
gtcgatcgcgaggccttgcgcgcgctggtccaacgctcgccggagaccccagccgcatcg
tcgccgcccgagacagaaaccgaacaggcaatcgcggaaatctggaaggacgcgctgggc
gtggcggccgtcggtcggcaggataacttcttcgatcttggcggtcattctctcctgctg
gccaagatcctcaccagccttcgttcgttgagtcgtcgtccgctcgcgatgctcgatctc
ttccggtatccgaccgtgcagtcgctggccgcgtatctcgagggaagcggggacggcacg
gatcgcggaggcgcggaggagaacgcggatctggcgcatcgcgcgaaagagcggcgcacg
gccggcgtgcgccggcttcgccggcagcgggaacagcggcaaggcgccaaagatggcatc
tga

DBGET integrated database retrieval system