KEGG   Niastella koreensis: Niako_0113Help
Entry
Niako_0113        CDS       T01679                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nko  Niastella koreensis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Niako_0113
  Energy metabolism
   00680 Methane metabolism
    Niako_0113
Enzymes [BR:nko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Niako_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(134240..136819)
Genome map
AA seq 859 aa AA seqDB search
MDHQSSRGLQQFKNYVGIKFQLYNSLFTSLPFHRIEKTGILLSLLLNNCEEGYKKKQSPM
QIIDEFFEKHTSYIKEQDKLDLLFRFIQYVERQVVLFDALEDASFREINDLNGIGTLKYL
AADVIQEGKEEELARKLEDFSIRLVLTAHPTQFYPGPVLGIIHDLSKALAENNTSQINMY
LQQLGKTPFFKKEKPTPFDEAISLIWYLENVFYNAAGRIITYLNNQFPQMIPDTNPVITM
GFWPGGDRDGNPFVTVDTTQKVADALRGSIIKCYYLEVRKLKRRLTFKGVDTILADLEKQ
LYENIFIPGQRTFLSKQGILDALQKIREILIYQHNGLFQHLVDNLINKVHVFGLHFASLD
VRQDSSIHGKVLEAIAAKTDILPKNYAELSEEEKKKLLYKASGDIGGHVFEDGIEKDTLL
SIKAIKEIQQYNGVEGCSRYIISQCNSALNLLEVYGLFKICGWKNEDLTIDIVPLFETID
DLQEAAEIMGELYENEIYRKHLQKRNNRQTIMLGFSDGTKDGGYLMANWSIYKAKEKLTS
ISAKYGIDVVFFDGRGGPPARGGGKTHKFYASMGKNISNKEIQLTIQGQTVSSNFGTIDS
AQFNIEQLLNAGISNDVFADKDKTLSAEEEEILGELCEEGLKSYNELKNNPDFLNYLAHV
SPLKFYSQTNIGSRPAKRGSSSKLSLKDLRAIPFVGAWSQLKQNVTGYYGVGTALQAMEK
KGKLNDIKKVYRHSLFFKTLMDNCEMAMKKCFFPLTEYLAQDPRYGEIWNQIYKEYELTQ
RYIFLLSGKSELMADYPVEQLSVQMRERIVLPLTTIQQYAMARIRLMEEQNAQQQHKEIF
EKLVIRSSFGIINAGRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccagtcatcacgaggactgcagcagtttaagaattatgtaggcataaaattt
cagctctacaacagtctgtttacctcgctcccgtttcatcgtattgagaaaacaggtatt
ctgctttcattattattaaataattgtgaagagggttataagaagaagcagagccccatg
cagatcatcgatgaattctttgaaaagcacacctcttatataaaagagcaggataagctc
gacctgttgttccgctttattcaatatgttgagcggcaggttgttttgttcgatgcactg
gaagatgcctctttcagggagatcaacgacctcaacggtattggaaccctcaagtacctg
gctgcagatgttatccaggaaggcaaagaagaagagcttgccaggaagctggaagacttc
tccatcaggctggtgctcaccgcccaccctacccagttctatcccggtcctgtattaggt
attattcatgacctgtcgaaagcactggcagaaaataataccagccagataaacatgtac
ctgcaacagctgggcaaaacgcctttctttaaaaaggaaaagcctactccattcgatgag
gccataagccttatctggtacctggaaaatgtattctataatgcagcaggccgcatcatt
acttatctcaacaaccagttcccgcaaatgatcccggataccaacccggttatcaccatg
ggcttctggcctggcggcgaccgcgatggcaacccctttgttactgttgacaccacacag
aaagtagcagacgccctgcgcggcagcatcataaaatgttattacctcgaagtacgtaag
ctcaaaagacgccttacattcaagggagttgataccattctggccgatctggaaaaacag
ttgtacgaaaacatctttattcccggtcagcgcaccttcctcagcaaacagggcatcctg
gatgcattacaaaaaataagagagatattaatctaccagcacaatggattattccagcac
ctggttgataacctcataaacaaagtgcatgtatttggattgcactttgcctcgctcgat
gtacggcaggacagcagcatccatggcaaggtactggaagcaatagctgcaaaaacagat
attcttccaaagaactatgcagagctctctgaagaagaaaagaaaaagctgttgtacaaa
gccagcggcgatattggcggacacgtatttgaagatggcattgaaaaagataccctgctc
agcataaaagccattaaagaaattcaacaatacaacggggttgaaggctgcagccgatac
atcatcagccagtgcaacagcgcactgaacctgctggaagtttacgggctgtttaaaata
tgcggctggaaaaatgaagacctcaccatcgatatcgttcccctgtttgaaaccatcgac
gacctgcaggaagcagccgagatcatgggtgaactgtatgagaatgagatctaccgcaaa
cacctgcaaaaacggaacaaccgccaaaccatcatgcttggtttttctgatggcaccaaa
gacggcggttacctgatggccaactggagtatttataaagccaaggaaaaacttaccagc
atttctgccaaatatggcatcgatgtggtgttcttcgatggccgcggtggtccgccggca
cgtggtggaggtaaaacccataagttctatgcatctatgggtaagaacatcagcaataaa
gaaattcaacttaccatacagggacaaaccgttagttccaacttcggcactatcgactct
gcccagttcaacattgagcaattgctgaatgccggtatctccaatgatgtatttgccgat
aaagacaaaacattatcagcagaagaagaagagatcctgggcgaactgtgtgaagaaggg
ttgaaatcctataatgaattaaagaacaaccccgatttcttaaattacctggcgcatgta
agtccgctgaagttctacagccaaacgaacatcggcagccggccggccaaacgcggttct
tcttcaaaactgtcactgaaagacctgcgggccattccgtttgtgggcgcctggagccag
ttaaaacaaaatgtaaccggttattatggggtgggcactgcattacaggccatggagaaa
aagggtaaattaaacgatattaaaaaggtttaccgtcattcattattcttcaaaacgctg
atggataattgtgagatggcgatgaagaagtgtttcttccccttaacggaatacctggcg
caggatccccggtatggtgagatctggaaccagatctataaagaatatgaactgacccaa
cgttatatcttcttattgtcgggcaaaagcgagctgatggcagattaccctgttgaacag
ctgtcggtacaaatgcgcgaacgtattgtgttgccattaactaccattcagcaatatgcc
atggcgcgtattcgcctgatggaagaacaaaacgcacaacagcagcataaagagatcttc
gagaaactggttatccgcagttcatttggtattatcaatgcaggccgaaactctgcataa

DBGET integrated database retrieval system