KEGG   Niastella koreensis: Niako_2333Help
Entry
Niako_2333        CDS       T01679                                 

Definition
(GenBank) Long-chain-fatty-acid--(acyl-carrier-protein) ligase
Organism
nko  Niastella koreensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2850703..2852622)
Genome map
AA seq 639 aa AA seqDB search
MLLTIFDFLSYHTAVAPFKTAFILTGTGGQPDRHISYSTLGKEVSTLASSLAAEQLNGER
VMLVYHDALAFIISFLACQQVGAIAVPAPPVYGNKQFARLQHIIVDAAPSAILCKEQTGR
FLQQVGQKIIFTDTSDQSSINTLPTPHDISFIQYTSGSTNKPKGVVVTHTNLIHNQQLLK
AAFNCTTASVIFSWLPFHHDMGLIGNILHTIFTGCTCVLMPAADFIQQPLRWLEGVSRYR
ATHSGGPNFAYDLCIEKIPAEKLNDIDLTRWKVAFNGSEPIRPATLRRFADHFAPAGFKE
DSFYPCYGLAEATLLVTARRDTTSPVITHNNRHFISSGSIAAGIDMKIIAADTKAVCNDL
EEGEICIAGESITSGYWQRDCTGLFHELDGTRFLRTGDTGFLHRGELFILGRSKEMLIVR
GKNIFPNDIEQAIAGVNPAIDSNGVAVFAMDSIGEKIAVVIEIKRPAIKTLNTEAIIYAI
EKLVAGRFGVTLHDIVLTSPFNIPRTTSGKLQRTRCPEWYSINRFNIIDSKEQLQKKAGI
QPANGMLLPRNVRNYLLHLITSKTGSPIDAQIADDVELAELGIDSLQLVELVNAVNREFD
LNIHPAMVMEHNTISMLAALLENMLWLKNEQNSDNEVII
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgcttctaacgatatttgattttttatcataccatacagcggttgccccgtttaagaca
gcctttattttaacaggtaccggtgggcagcccgacaggcatatttcctattcaactctc
gggaaagaagtaagcacgctggcctcctcattggctgcggagcaactcaatggcgaaagg
gttatgcttgtttatcacgatgcgctggcttttatcatctcttttttagcctgccagcag
gtgggtgctattgcggtaccagctccccctgtttatggaaataagcaattcgccaggtta
caacatatcatcgttgatgcagccccttcggcgatcttatgtaaggaacaaaccggccgg
tttttgcaacaggtggggcagaaaataatttttaccgacacatcggatcagtcatcaata
aatacgttaccaactccacacgatatttcgttcattcaatacacgtcaggttctaccaac
aaaccgaaaggggtcgttgtcacccatacgaaccttattcacaatcaacaactgcttaaa
gcagccttcaattgtactaccgcttcggttattttttcctggctgccctttcatcatgat
atgggtttgatagggaatatacttcataccatttttaccggttgtacctgcgtactcatg
cctgctgcagattttatacagcagccgttgcgctggcttgaaggggtatcaagatacaga
gcaacacacagcggcgggcctaattttgcgtatgatctgtgtatcgaaaaaattcccgca
gaaaagttgaatgacatcgaccttacccgctggaaagtggcctttaatggctcggaaccc
atcaggcccgcaacactgcgccgttttgcagatcattttgcaccggcaggatttaaagaa
gacagcttttatccatgttatggccttgctgaagccaccttgctggtaacagcgcgcaga
gacacgacttcgccggttattacacataacaacaggcattttattagttccgggtccatc
gctgccggtattgacatgaagatcattgcggcagataccaaagcagtatgtaacgacctg
gaagaaggagaaatatgtattgcgggtgaaagtataaccagcggttactggcagcgggat
tgtaccgggttgtttcatgaattggatggaacacgttttctcagaacaggcgataccggt
tttctgcatcggggcgaattatttattctgggaagatcaaaagagatgctgatagtacgt
ggtaaaaacatttttcctaacgatatagaacaggcaattgcgggtgttaatccggctatc
gacagcaatggagtagccgtttttgcaatggacagcataggggagaagatagcggttgtt
attgaaataaaaagaccggctatcaaaacactgaatacagaggcgatcatttacgcaatt
gaaaaactggttgcaggccggtttggggtcacattacatgacattgttttaacgtcccca
ttcaatattccaagaacgaccagcggaaaactacaacgcacccggtgccccgaatggtat
agcattaaccggtttaatataatagactcaaaagaacaactacagaaaaaagcaggcatc
caacccgcaaatgggatgttattgccgcggaacgtcaggaattatttgttacacttaata
acaagcaaaaccggttctcccatcgatgcgcagatagcagatgacgttgaacttgccgaa
ctgggcatcgattccctgcaactggttgaactggtaaatgccgtgaacagggaatttgat
ctgaatattcaccccgccatggtgatggagcataatacgatctccatgctggccgcttta
ttagaaaatatgctgtggttgaaaaacgagcaaaactccgataacgaagtcataatatga

DBGET integrated database retrieval system