KEGG   Niastella koreensis: Niako_2799Help
Entry
Niako_2799        CDS       T01679                                 

Definition
(GenBank) glycosyl hydrolase BNR repeat-containing protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
nko  Niastella koreensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Niako_2799
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Niako_2799
Enzymes [BR:nko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Niako_2799
Bacterial toxins [BR:nko02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Niako_2799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3494354..3496018)
Genome map
AA seq 554 aa AA seqDB search
MKLNIFITKVILICLIPAFAVARPSGDIVISQQHYQVPILLQKKDNPVLRIHLHNGSAGD
LQLTEMMFNVAGTTDCKDIKQFNLYYTGADSGMRNLGSVEKIQLVGSVTKVGEKLSVTGS
QSLSPGDHYFWLSVELNKGVPLTHVVAVNATNAMMNGKSTKIEGVAKFQQRIGIALRQHN
QDSVHTYRIPGLSTAKDGSLLAIYDVRRESARDLQGNIDIGVSRSTDGGNTWLPMQIAID
MGKWGGLPEKFNGVSDANVLVDKNTGAIFIAGLWMHGVLSEEGIWVEWLTDTSTNWNHQW
RNKGSQPGFDEKHSAQFMIVKSVDNGKTWSKPVNITQQCKQEAWWLWAPAPGAGITLHDG
TLVFPTQGRDKSGKAFSNITYSKDGGVTWHTSNRASKESTTENMAVELSDGTVMLNMRCN
KNQKDTGDTNGRVIAITRNLGEDWTEHPTSRGALHEPVCMASILRHKYVVKGQKKSILLF
ANPDSKTLRHHMTIKVSYDDGATWQTNKKILLDEWKSRGYSCMTSIDAETIGIVYESSQC
DLVFQQVKIKELLP
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaatatatttattacgaaggttattttgatatgtttgattccggcgtttgcg
gttgcgcgcccttctggtgacatcgtaatatcccagcaacactaccaggtacctatttta
ttgcagaaaaaagacaatcctgttttgcgaattcatttgcataatggaagcgccggtgat
ttgcagttaactgaaatgatgtttaatgttgctggtactaccgactgtaaggatattaaa
caattcaatctgtattataccggcgcggattcgggtatgcgcaacctgggtagtgtagag
aaaattcagttggtgggtagcgtaaccaaagtaggagagaagctgtcggtaacgggttcg
caatcattaagtccgggcgatcattatttctggctgtcggttgaattgaacaagggcgtt
cctttaacgcatgttgtagcagtcaacgccaccaatgccatgatgaatggcaagtcaaca
aagattgaaggcgttgccaaatttcagcaacgtataggtattgctttgcggcaacataac
caggatagcgtgcatacgtatcgcattcccgggttgtcaacagccaaagatggttcattg
ctggccatttatgatgtgcgacgcgaaagcgcccgtgatctgcaggggaatatcgatatc
ggggtaagccgcagtaccgatggcggcaatacctggctgccgatgcagattgcgatcgat
atgggtaaatggggtggactgcccgaaaaattcaacggcgtttctgacgcaaatgtgctg
gttgataaaaacacaggtgccatttttatcgccggcttatggatgcatggcgttttgagc
gaggaagggatatgggtggaatggcttacggataccagcactaactggaatcatcaatgg
cggaataaaggatcacaaccggggtttgatgaaaaacacagcgcgcagtttatgatcgta
aaaagtgtggacaatggaaagacctggagcaaaccggtgaatattactcaacaatgtaaa
caggaagcctggtggttgtgggccccagcgcccggtgcaggtattacgctgcatgatggc
accctggtatttcctacacaaggccgcgataaaagcgggaaggcattttccaacatcacg
tacagcaaagatggcggcgtaacctggcataccagcaatcgcgcttcaaaagaatccacc
accgagaatatggcggtggagttgagcgatggcacggttatgttgaacatgcgctgcaat
aaaaatcaaaaagatactggtgacaccaacggccgggtaattgccataacccgtaacctg
ggtgaggattggactgaacatccaaccagccgtggtgctttacacgaaccggtttgtatg
gccagcatcctgcggcataagtacgtggtgaagggacaaaagaaatcgatcctgttattt
gccaatcccgattcaaaaacactgcggcatcatatgaccatcaaagtaagttatgatgat
ggcgccacctggcaaaccaataaaaagatcctgctcgatgaatggaaaagccgcggctac
tcctgtatgaccagcatcgatgccgaaacgattggcattgtatatgaaagcagccagtgc
gacctggtgtttcaacaggtaaaaattaaagagttgttaccgtag

DBGET integrated database retrieval system