KEGG   Niastella koreensis: Niako_5041Help
Entry
Niako_5041        CDS       T01679                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
nko  Niastella koreensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Niako_5041
  Amino acid metabolism
   00310 Lysine degradation
    Niako_5041
   00380 Tryptophan metabolism
    Niako_5041
Enzymes [BR:nko01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Niako_5041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6238474..6241236
Genome map
AA seq 920 aa AA seqDB search
MKDFSYITNSHPAFIENLYQDFLQDPNSVDPDLKKFFEGFDFAVGQGKNGTTNGTAAVAG
ETSGATGESFDWKKEVGAYRLILGYRNKGHLIAKTNPIRQRKDRGANLDLGFYGFTEADL
DKTLNAGNMIGLGTTTLRNILTHMQKTYAGHVGIEFKYISDQKKVDWLTNEMERNFSKPL
AINKKKRILEKLNQGVIFEKFLHTKYIGQKRFSLEGGESTIAALDEIITTAANNDVQEVV
IGMAHRGRLNVLANIMGKTYEQIFSEFEGTAKPDQTMGSGDVKYHMGYGSEVETPDGKTI
HLKLMPNPSHLETVDPVVIGFARAKADVLYKSDFDKILPILIHGDASVAGQGIVYEVLQM
SDLDGYYTGGTIHFVINNQIGFTTDFEDARSSDYCTSLAAMIQAPVLHVNGDDAEAVVKC
VQIATRYRQEFNSDVFIDMVCYRKHGHNEGDDPKFTQPQLYALIEKHANPREVYTRFLQE
TGEPDALDLAKEMEKKFWADLQERLDEIKQKPLPYHYQQPELAWKNLRKATEADFEKSPV
TALDEASFKKVFDAIMKWPADFTPLKKVEKIIQEKVKLFNEEGKLDWATGELLAYGSLLL
EGNDVRMSGQDVRRGTFSHRHAVLRDEKTDKAYSRLSEIPGANGQFRIYNSLLSEYGVLG
FEYGYAMANPNSLVLWEAQFGDFSNGAQIMIDQFISAGEQKWNRMNGITLLLPHGYEGQG
PEHSSARMERFLQMCAEMNMVVTNITTAANLFHALRRQLIWSFRKPLINFSPKAKLRDPG
TYSPTKEFLNGGFKEVIDDTFVTDASSVRKVLFCSGKVYFDLAERQQKENKKDTAIIRLE
QLYPLPVKQLEALYSKYNKATWFWVQEEPLNMGAASFLQMNLKSINYGVISRQPSAATAT
GYAKVHAQEQTEIIDTAFSI
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatttttcgtatatcaccaattcccacccggcctttattgaaaacctgtatcag
gatttcttacaagacccaaacagtgttgatcccgaccttaaaaaattttttgaaggattt
gactttgccgtgggacaaggtaaaaatgggacaacgaacggaacggcagcagtagcaggt
gaaacatccggcgctaccggcgaaagcttcgactggaaaaaagaagtaggcgcctaccgc
cttattctgggttaccgcaacaaaggccacctgattgctaaaaccaaccccattcgccag
cgcaaagaccgtggcgccaacctggacctgggtttttatggttttaccgaggctgatctc
gataaaaccctgaatgcaggcaatatgatcgggttgggaaccaccacactccgcaatatt
ctcacccacatgcaaaagacctatgccgggcatgtagggatcgagttcaaatacatcagc
gatcagaagaaagttgactggcttaccaacgaaatggagcgcaacttctccaaaccgctg
gccatcaacaagaaaaaacgcatcctggaaaaactgaaccagggcgtgatcttcgagaaa
ttcctccacaccaaatacatcggccagaagcgattctccctggaaggtggcgaaagcact
attgctgcgctggacgagatcattactactgccgccaataacgacgtgcaggaagtagtg
atcggcatggcgcaccgcggccgcctgaacgtactggccaacatcatgggtaaaacctat
gagcagatcttcagtgaatttgaaggtaccgccaagcccgaccaaaccatgggcagcggc
gacgtaaaataccacatgggttatggcagcgaggtggaaacacccgatggcaaaaccatt
cacctgaagctgatgcccaacccatcgcacctggaaacagttgatccggttgtgattggc
ttcgcccgggcaaaagccgatgttctgtacaaaagcgatttcgacaaaatattacctata
ctcatccatggcgacgcgtcagttgcaggccagggtattgtttacgaagtactgcaaatg
agcgacctcgatggttactacactggcggcaccattcacttcgtgataaataaccagatc
ggtttcaccaccgattttgaagacgcccgcagctctgactactgtacatcgctggcagcc
atgattcaggcgcccgtgttacacgtaaatggcgacgatgcagaagcagtggttaaatgc
gtacaaatagctacccgctaccgccaggaatttaactccgatgtgttcattgacatggtt
tgttaccgcaaacatgggcacaacgaaggcgacgatcctaaattcacgcagccacaactg
tatgcactgatcgaaaaacacgccaacccgcgtgaagtgtatacccggttcctgcaggaa
accggcgaacctgacgccctggacctggccaaggaaatggaaaagaaattctgggccgac
ttgcaggaacgcctcgatgaaataaaacagaaaccactcccctatcattaccaacaaccc
gaactggcctggaagaatttgcggaaagccactgaggccgactttgaaaagtcgcccgtt
accgctctcgacgaagccagctttaaaaaggtatttgatgccatcatgaaatggcctgcc
gatttcacgccgttgaaaaaggtagaaaagatcatccaggaaaaagtaaaactattcaac
gaagaaggtaaacttgactgggcaaccggtgagttgctggcttatggaagcctgctgctg
gaaggaaatgatgtgcggatgagcggacaggacgttcgccgcggtaccttctcacaccgc
catgctgttttgcgcgatgagaaaaccgacaaagcatacagcagattaagcgagatcccc
ggcgccaacggtcaattcagaatatacaattctttacttagcgaatatggtgtactgggc
tttgagtatggctatgcaatggccaaccccaacagcctggtattatgggaagcccagttt
ggcgatttcagcaatggcgcccagatcatgatcgaccagttcatttcggccggcgaacaa
aaatggaaccgcatgaacggtataaccctgttgttgccgcacggttatgaaggtcaggga
cctgaacatagcagcgcccggatggaacgcttcttacaaatgtgcgctgaaatgaatatg
gtagtaactaatattaccacagccgccaacctgttccatgccctgcgtcgccagttaatc
tggtcgttccgcaaaccgctgatcaacttctcacccaaagccaaactccgtgacccgggt
acttactcgccaacaaaggagttcctgaacggcggcttcaaagaggtgatcgatgatact
tttgtaacggacgcctccagcgtacgcaaggtgttgttctgcagcggtaaagtatacttt
gacctcgcagagcgtcagcaaaaagagaacaagaaagacaccgctatcatccgtcttgaa
cagttgtatcctttacctgttaaacaactggaagctttgtattccaaatacaataaagca
acctggttctgggtacaggaagaaccactgaacatgggcgcggcctccttcttacaaatg
aacctgaagagcattaattatggtgttatcagccgtcagccaagcgctgctaccgccacc
ggttatgccaaggttcacgcacaggagcagactgagatcattgataccgctttttcaata
taa

DBGET integrated database retrieval system