KEGG   Candidatus Nitrosopumilus koreensis: NKOR_07615Help
Entry
NKOR_07615        CDS       T02304                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
nkr01100  Metabolic pathways
nkr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nkr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    NKOR_07615
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NKOR_07615
Enzymes [BR:nkr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NKOR_07615
Peptidoglycan biosynthesis and degradation proteins [BR:nkr01011]
 Precursor biosynthesis
  Amino acid ligase
   NKOR_07615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 ATP-grasp_3 Peptidase_M20 CPSase_L_D2 ATPgrasp_Ter RimK ATP-grasp GARS_A ATPgrasp_ST DUF4343
Motif
Other DBs
NCBI-ProteinID: AFS81384
UniProt: K0B7E5
LinkDB All DBs
Position
complement(1268273..1270435)
Genome map
AA seq 720 aa AA seqDB search
MKVSLIYNEKQIDPNDVINVFGMTTKEHYSPKAVERVARALEKGGHAVKVIEGDMHLADE
LREFMPKVVSGENPGMVFNMAYGIQGQNRYTHVPAMMEMLGIPYIGSGPAGHAIVQDKVM
TKIVLQRNNIPTPGFWVFKTPEDVFDDLVFPVIVKPKLESTSMGMEVVDNWNDLRKAVKT
QIEKFQQDILVEQFISGREFAVGLIGNSPNIEVLPVVEINLGHPDQIQTISDKKKIGGVD
KTCPAKISKEKTEEIKQMCIQAFAALGLNDYSRVDFRMDKDGNLYILELNSMASLGIGGS
LFYAAKTAGYTYESLINKILDVATIRYFGSSHLAETEPDLTQPLRIVARTYLRSHLQSQK
ETLRNFVNLNTHVYNIDNVNKLGSMLSRRMKHLGFSEHLYRQLDVGDIRYFKNHDEEKND
VLIISHMDTHYGPNDLISYFEDDDRIYGSGIAESKGGLTVMLGALHALRYSKRLKKIKCG
VLLTTDDSLGGRFSKKLVQQYSRKSKYIIGLKSASKEGGIITTCYGRNDYQIRFTTPPNS
TSSDIHGIIPILGKKIAAIEKLSKDEKNYRLRTTSVVAQGTHGHTPNYATLTLVCSFKTP
ALGKTMDSKIRTIMQKKESGQKNLEVAINQIQTRPPVIEEASDKRFYEIVEELAKKHELK
IKRHEQIMSSDISNVPSRLPALDGFGPIGHRYRSTQEYILHDSIVERSALLASVLYRCSK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtttctttaatctataacgaaaaacaaattgatccaaatgacgtaatcaacgtt
tttggcatgactacaaaagagcattacagtccaaaagctgttgaaagagttgcaagggct
ttagaaaaaggtggtcatgctgttaaagttattgaaggtgatatgcatcttgccgatgag
ttacgtgagtttatgccaaaagtagtttcaggcgagaaccctggaatggttttcaatatg
gcatacggaattcaaggacaaaacaggtacactcatgttcctgcaatgatggagatgctt
ggaatcccttacattggctcaggccctgcgggccatgcaattgtacaagacaaagtaatg
acaaaaattgttctgcaaagaaacaacattcctacccctggcttttgggtgttcaaaact
ccggaggatgtatttgatgatctggtatttccagtcattgtaaaaccaaaattagaatct
acatccatgggtatggaagtagtagataactggaatgatctgagaaaagcagtgaaaaca
caaattgagaaattccaacaagatatactagttgaacagtttatttctggacgggaattt
gcagtgggacttattggaaacagtccgaatatagaagttcttccagttgttgaaattaat
cttggtcatcctgatcaaatacagacaatttctgacaaaaaaaaaataggtggagttgat
aaaacatgtcctgcaaaaatatccaaagaaaaaacagaggagataaaacaaatgtgcata
caagcatttgctgcattggggctgaatgattatagtagagtggattttaggatggacaaa
gatggaaatctttacattcttgaactaaactccatggcgagtttaggtataggtggctct
ttgttttatgctgccaaaacagcaggatacacttacgaatctttaatcaataaaatttta
gatgttgcaacaataagatattttggttcttctcatctggcagaaacagaacctgatctt
actcaacctcttcgtatcgttgcccgtacttatttgagaagccatctgcaaagtcaaaaa
gaaactttacgaaattttgtcaacctgaatacccatgtatataatattgataatgtgaac
aagttaggctcaatgttgtctagaagaatgaaacatcttggtttctctgagcatttgtat
aggcaacttgatgttggagatatacgttattttaaaaatcatgacgaagagaaaaatgat
gtactgataatttctcatatggatacccattacggaccaaatgatcttatttcatatttt
gaagacgatgatagaatttatggttctggaatagctgaaagtaaagggggcttgaccgta
atgttaggtgcattgcacgccttacgctattcaaaacgtctcaagaaaatcaaatgcggt
gttttgcttacaactgatgatagtctgggcggacgttttagcaaaaaacttgtccaacaa
tattctagaaaatcaaaatatatcatcggattaaaatctgcaagtaaagaaggtggaatt
attacaacgtgttatggtagaaatgattatcaaattagatttactactccgcctaactct
acatcttctgatatacatggaatcattccaatacttggcaaaaagattgcagcaattgaa
aagctttcaaaagatgaaaaaaattatcgtttgagaacaacatctgttgttgcacaaggc
actcatggacatactccaaattatgccaccctgacattagtatgtagtttcaaaactcct
gcactggggaaaacaatggattctaagattagaaccattatgcaaaagaaggaatctgga
caaaaaaacctagaagttgcaataaaccaaatacaaacaagacctcctgttattgaggaa
gcatctgataaacggttttatgaaattgtggaggaactagctaaaaaacatgagttgaaa
ataaaacgtcatgaacagataatgtcttcagatattagtaacgtgccttctagattgcct
gcattagatggatttggtcctattggtcatagatatcgttccacccaagaatatatcctt
catgacagcatagtagaacgctctgcattactggcatcggtattatatcgatgtagtaaa
tag

DBGET integrated database retrieval system