KEGG   Nitrosospira lacus: EBAPG3_001970Help
Entry
EBAPG3_001970     CDS       T04907                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nlc  Nitrosospira lacus
Pathway
nlc00630  Glyoxylate and dicarboxylate metabolism
nlc01100  Metabolic pathways
nlc01120  Microbial metabolism in diverse environments
nlc01200  Carbon metabolism
Module
nlc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nlc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EBAPG3_001970
Enzymes [BR:nlc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     EBAPG3_001970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ARO86643
UniProt: A0A1W6SLH1
LinkDB All DBs
Position
complement(444161..444595)
Genome map
AA seq 144 aa AA seqDB search
MMTNVGNRITQGQFSFLPPLTDKQISAQIKYALKNNWAIGIEYTDDPHPRNTYWEMFGNP
MFDLKDPAGILSEINDCRKTYPNHYIRVTAFNSTRGVESPTMSYIVNRPKTEPGFGLVRQ
EVEGRSIRYTIHSYATDKAESERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaatgtaggaaatcgcatcacgcaggggcaattctctttcctgccgccactg
acggataaacaaatttccgcacaaatcaaatatgcgttgaaaaacaattgggcgataggt
atcgagtacaccgacgatccccacccgcgcaatacgtattgggaaatgttcggcaatccg
atgtttgacttgaaagatcccgccgggatcctgtcggaaatcaatgactgccgcaaaact
tatccgaatcattatatccgggtaaccgcatttaactcgacgcgcggggtggaaagtccg
actatgtcgtatatcgtcaaccgtccgaagacagaaccgggctttggcctggtacgccag
gaagtggaaggccgtagcattcgttacaccattcattcctacgcaactgacaaagcggaa
tccgaacggtattaa

DBGET integrated database retrieval system