KEGG   Nitrosospira lacus: EBAPG3_006400Help
Entry
EBAPG3_006400     CDS       T04907                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
nlc  Nitrosospira lacus
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nlc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EBAPG3_006400
   00620 Pyruvate metabolism
    EBAPG3_006400
   00630 Glyoxylate and dicarboxylate metabolism
    EBAPG3_006400
  Energy metabolism
   00680 Methane metabolism
    EBAPG3_006400
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EBAPG3_006400
Enzymes [BR:nlc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     EBAPG3_006400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1438615..1439598
Genome map
AA seq 327 aa AA seqDB search
MKPPIRIAVTGAAGQIGYSLLFRIAAGDMLGNDQPVFLQLLDIPRLLPSLKGVMMELEDC
AFPLLAGVIATDDPNTAFRDISIAMLVGARPRGKGMERKDLLEANGAIFTTQGRALDEVA
RRDVKVLIVGNPANTNAYIAMKNAPGLKPENFSAMMRLDHNRALSQIAAKVGQPVSSIRK
VIIWGNHSATQYPDLNHAETDGNKISLLINDPAWIEDYFIPTVQKRGAVVIEARGSSSAA
SAANAAINHVRDWVLGTRENDWISMGIPSDGSYGIPEGVIYGYPVTCRDGVYRIVPDLEI
SEFSQAKMQATYGELVEERDSVKHLLG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccccattcgtatcgccgtcacgggcgccgccggccagatcggctacagtttg
ctgtttcgcatcgccgcaggcgacatgcttggcaacgatcagcctgtttttctgcaattg
ctcgacatacccaggttgctgccttcgctcaagggagtaatgatggaactggaggactgc
gcattcccgctactggctggcgtaatcgccacggatgatcccaacaccgctttccgtgac
attagcatcgcgatgctggtgggcgcccgtccacgcggcaagggcatggagcgtaaagac
ctgctggaagcgaatggggcgatatttaccacccagggcagggcactggatgaagtagcc
cgccgtgatgtcaaggttctgatagtgggcaatcccgccaataccaatgcttacatcgcg
atgaaaaacgctcccggcctgaagccggaaaacttctcggcaatgatgcggctggaccac
aatcgcgccctgtcgcaaattgccgctaaagtcgggcaaccggtttccagcatcagaaaa
gtaatcatctggggtaatcactccgctacacaatatcccgacctgaatcatgccgagact
gacggcaacaaaatctcccttcttatcaacgatcctgcatggatagaagactatttcatc
cccaccgtacaaaaacgcggtgcagtggtaatcgaagcgcgcggctcgtcaagtgccgcc
agcgcggcgaatgccgccatcaatcatgttcgtgactgggttttgggtacgcgggaaaat
gactggatatccatgggaataccatcggatggcagctatggcattcccgagggcgttatc
tacggctatccggtaacctgccgggatggggtctaccgaatcgtccctgacctggagata
agcgaattcagccaagcgaaaatgcaggcgacctacggggaattggtggaagagcgggac
tctgtcaaacatctgcttggataa

DBGET integrated database retrieval system