KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100606392Help
Entry
100606392         CDS       T03265                                 

Gene name
PCSK1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
Enzymes [BR:nle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100606392 (PCSK1)
Peptidases [BR:nle01002]
 Serine Peptidases
  Family S8: subtilisin family
   100606392 (PCSK1)
Chaperones and folding catalysts [BR:nle03110]
 Intramolecular chaperones
  Subtilisin family
   100606392 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
2
AA seq 740 aa AA seqDB search
MERRAWSLQCTAFVLFCAWCALNSAKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSALRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALK
ANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVDPGEWCQKPSSSSVGSRRDELEEGXPSEAMLRLLQS
AFSKNSLPKQSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKP
YKHRDDRLLQALVDILNEEN
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaagagcctggagtctgcagtgcactgctttcgtcctcttttgcgcttggtgt
gcactgaacagtgcaaaagcgaaaaggcaatttgtcaatgaatgggcagcggagatcccc
gggggcccggaagcagcctcggccatcgccgaggagctgggctatgaccttttgggtcag
attggttcacttgaaaatcactacttattcaaacataaaaaccaccccagaaggtctcga
aggagtgcctttcatatcactaagagattatctgatgatgatcgtgtgatatgggctgaa
caacagtatgaaaaagaaagaagtaaacgttcagctctaagggactcagcactaaatctc
ttcaatgatcccatgtggaatcagcaatggtacttgcaagataccaggatgacagcagcc
ctgcccaagctggaccttcatgtgatacctgtttggcaaaaaggcattacgggcaaagga
gttgttatcaccgtactggatgatggtttggagtggaatcacacggacatttatgccaac
tatgatccagaggctagctatgattttaatgataatgaccatgatccatttccccgatac
gatcccacaaatgagaacaaacatgggaccagatgtgcaggagaaattgccatgcaagca
aataatcacaaatgcggggttggagttgcatacaattccaaagttggaggcataagaatg
ctggatggcattgtgacggatgctattgaggccagttcaattggattcaatcctggacac
gtggatatttacagtgcaagctggggccctaatgatgatgggaaaactgtggaggggcct
ggccggctagcccagaaggcttttgaatatggtgtcaaacaggggagacaggggaagggg
tccatcttcgtctgggcttcgggaaacggggggcgtcagggagataattgtgactgtgat
ggctacacagacagcatctacaccatctccatcagcagtgcctcgcagcaaggcctatcc
ccctggtacgctgagaagtgctcctccacactggccacctcttacagcagcggggattac
accgaccagagaatcacaagcgctgacctgcacaatgactgcacggagacacacacgggc
acctcggcctctgcacctctggctgctggcatcttcgctctggccctggaagcaaaccca
aatctcacctggcgagatatgcagcacctggttgtctggacctctgagtatgacccgctg
gccaataaccctggatggaaaaaaaatggagcaggcttgatggtgaatagtcgatttgga
tttggcttgctaaatgccaaagctctggtggatttagctgatcccaggacctggaggagt
gtgcctgagaagaaagagtgtgttgtaaaggacaatgactttgagcctagagccctgaaa
gctaatggagaagttatcattgaaattccaacaagagcttgtgaagggcaagaaaatgct
atcaagtccctggagcatgtacaatttgaagcaacaattgaatattcccgaagaggagac
cttcatgtcacacttacttctgctgctggaactagcactgtgctgttggctgaaagagaa
cgggatacatctcctaatggctttaagaattgggacttcatgtctgttcacacatgggga
gagaaccctataggtacttggactttgcgaattacagacatgtctggaagaattcaaaat
gaaggaagaattgtgaactggaagctgattttgcatgggacctcttctcagccagagcat
atgaagcagcctcgtgtgtacacgtcctacaacactgttcagaatgacagaagaggggtg
gagaagatggtggatccaggggagtggtgtcaaaagcccagcagcagcagcgtagggagc
cggagggatgagttggaggagggangcccttccgaggccatgctgcgacttctgcaaagt
gctttcagtaaaaactcattgccaaagcaatcaccaaagaagtccccaagtgcaaagctc
aacatcccttacgaaaacttctacgaagccctggaaaagctgaacaaaccttcccagctt
aaagactctgaagacagtctgtataatgactatgttgatgttttttataacactaaacct
tacaagcacagagatgaccggctgcttcaagctctggtggacattctgaatgaggaaaat
taa

DBGET integrated database retrieval system