KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100607081Help
Entry
100607081         CDS       T03265                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
Enzymes [BR:nle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100607081 (TMPRSS9)
Peptidases [BR:nle01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100607081 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 100607081
NCBI-ProteinID: XP_003277108
LinkDB All DBs
Position
17
AA seq 892 aa AA seqDB search
MEPTVADEHLVPRTTKEVSAPDAACCRVATIGVVATSLVVLTLGVLLAFLSTQGVHVDHT
AELRGIQWASSLRRETSDYHRTLTPTLEALATGNEAEVEAVRPGRQAMGRARRGQVAKAE
CGLQPAWRMAGRIVGGVEASPGEFPWQASLRENKEHFCGATIINSRWMVYAAHCFHEFQD
PTEWVAYVGATYLSGSEASTVRARVAQIVKHPLYNADTADFDVAVLELASPLPFSRHIQP
VCLPAATHIFPPRKKCLISGWGYLKEDFLVKPEVLQKATVELLDQALCASLYGHSLTDRM
VCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYARVTRLRDW
ILEATTKASVPLAPTVAPAPAAPSTAWPTSPESPVISTPTKSTQAPSTVPLDWVTVPKLQ
ECGARPAMEKLIRVVGGFGAASGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTK
VEQVRAHLGTASLLGLGGSPVKIGLRRVVLHPLYNPGILDFDLAVLELASPLAFNKYIQP
VCLPLAIQKFPVGRKCMISGWGNTQEGNATMPRFLKGSTGDSGGPLACEEAPGVFYLAGI
VSWGIGCAQIKKPGVYTRITRLQGWILEIMSSQPIPVSPTSTTRMLATTSPRTTAGLTVP
GATPSRPTPGVASRVTGQAANSTLSAVSTTARGQTPFPDTPEATTHSQLPDCGLAPAALT
RIVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVAERWLLSAAHCFDVRARGRGGAGLGGG
RTRSPPARSHSPAGSMARQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCSG
DAGGPLACREPSGRWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIGQHIQE
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggagcccactgtggctgacgaacacctcgtgcccaggacaaccaaagaagtctctgct
ccggatgccgcgtgctgtcgagtggccaccattggcgtggtggccaccagccttgtcgtc
ctcaccctgggagtccttttggccttcctctccacacagggcgtccacgtggaccacacg
gccgagctgcggggaatccagtgggccagcagtttgcggcgggagacctcggactatcac
cgcacactgacgcccactctggaggcactggccacaggcaacgaggctgaggtggaggct
gtgagaccgggacgccaggccatggggcgggcaagacgaggccaggtggccaaggcagaa
tgtggcttgcagcctgcctggaggatggccggcaggatcgtgggcggcgtggaagcgtcc
ccgggggagtttccgtggcaagccagccttcgagagaacaaggagcacttctgtggggcc
accatcatcaactccaggtggatggtgtatgccgctcattgcttccatgagttccaagac
ccgacggagtgggtggcctatgtgggtgccacctacctcagtggctcggaggccagcacc
gtgcgggcccgggtggcccagatcgtcaagcaccccctgtacaacgcggacacagccgac
ttcgacgtggcagtgctggagctggccagccctctgcctttcagccggcacatccagccc
gtgtgcctcccggctgccacacacatcttcccaccccgcaagaagtgcctgatctcaggc
tggggctacctcaaggaggacttcctggtcaagccagaggtgctgcagaaagccactgtg
gagctgctggaccaggccctgtgtgccagcctgtacggccactccctcactgacaggatg
gtgtgtgctggctacctggacgggaaggtggactcctgccagggtgactcaggaggaccc
ctggtctgcgaggagccctctggccggttctttctggctggcatcgtgagctggggaatc
gggtgtgcggaagcccggcgtccaggggtctatgcccgagtcaccaggctacgtgactgg
atcctggaggccaccaccaaagccagcgtgcctctggcccccacggtggctcctgccccc
gccgcccccagcacggcctggcctaccagtcctgagagccctgtgatcagcacccccacc
aaatccacgcaggcccccagcactgtgcctcttgactgggtcaccgttcctaagctacaa
gaatgtggggccaggcctgcaatggagaagctcatccgggtcgtgggcgggttcggagct
gcctccggggaggtgccctggcaggtcagcctgaaggaagggtcccggcacttctgtggc
gcaaccgtggtgggggaccgctggctgctgtctgccgcccactgcttcaaccacacgaag
gtggagcaggttcgggcccacctgggtactgcgtccctcctgggcctgggtgggagtccg
gtgaaaattgggctgcggcgggtggtgctgcaccccctctacaaccctggcatcctggac
ttcgacttggctgtcctggagctggccagccccctggccttcaacaaatacatccagcct
gtctgcctgcccctggccatccagaagttccctgtgggccggaagtgcatgatctctgga
tggggaaatacgcaggaaggaaatgccaccatgcccagatttctgaagggctcaactggt
gattctgggggccccttggcctgcgaggaggcccccggcgtgttttatctggcagggatt
gtgagctggggtattggctgtgctcagattaagaagccgggtgtgtacacgcgcatcacc
aggctacagggctggatcctggagatcatgtcctcccagcccattcccgtgtctcccacc
tcgaccacaaggatgctggccaccaccagccccaggacgacggctggcctcacagtccca
ggggccacacccagcagacccacccctggggtggccagcagggtgacgggccaagctgcc
aactcaaccttatctgccgtgagcaccactgctaggggacagacgccatttccagacacc
ccggaggccaccacgcactcccagctaccagactgcggcctggcgccggccgcgctcacc
aggattgtgggcggcagcgcagcgggccgtggggagtggccatggcaggtgagcctgtgg
ctgcggcgccgggaacaccgctgcggggccgtgctggtggcagagaggtggctgctgtcg
gcggcgcactgcttcgacgtgcgcgcccggggccgcggtggtgcgggactcgggggcggc
cggacgcggtccccacccgcccggtctcactcgcccgcaggctccatggcacggcagctg
cagaaggcggccgtgcgcctcctcagcgagcagacctgccgtcgcttctacccggtgcaa
atcagcagccgcatgctgtgtgccggcttcccgcagggtggcgtggacagctgttcgggt
gatgctgggggacccctggcctgcagggagccttctggacggtgggtgctaactggggtc
accagctggggctatggctgtggccggccccacttcccaggtgtctatacccgggtggca
gctgtgagaggctggataggacagcacatccaggagtga

DBGET integrated database retrieval system