KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0931Help
Entry
NMC0931           CDS       T00458                                 

Gene name
sucA
Definition
(GenBank) putative 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMC0931 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    NMC0931 (sucA)
   00380 Tryptophan metabolism
    NMC0931 (sucA)
Enzymes [BR:nmc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NMC0931 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
929658..932486
Genome map
AA seq 942 aa AA seqDB search
MMDEKLNFSYLFGSNAPYIEELYEAFLENPDAVDEKWKQYFTDLSKQPGTVAVDVAHTPI
RESFVTLAKKKIASAVAGGADEAMLKKQVSVLRLISAYRIQGVGAAQLDPLKRIPPRDIE
ALDPKFHGLSDADMALQFNMGEGDFANRGKLPLSQIISNLKQTYCGHIALEYIYIPNTEE
RRWVRNYFESVLSTPHYNADQKRRILKEMTAAETLERYLHTKYVGQKRFGVEGGESAIAG
LNYLIQNAGKDGVEEVIIGMAHRGRLNVLVNILGKKPGDLFAEFEGRAEIKLPSGDVKYH
MGFSSDIATPHGPMHVSLAFNPSHLEIVNPVVEGSARAKQKRLGENGRDKVLPVLIHGDS
AFIGLGVNQATFNLSKTRGYTTGGTVHIVINNQIGFTTSDIRDTRSTVHCTDIAKMVSAP
VIHVNGDDPERVCFAIQAALDYRKKFHKDIVIDVVCYRKWGHNEGDDPTLTQPMMYKKVS
QHPGARALYTEQLIAEGVVTQAEADGYIQAYRDALDKGEHVEQTTLSNFQRTQIDWSKYQ
GKDWREHIETDLPAADIERLTEKFTAVPEGFALHPTAKRVIEARKAMASGKQAIDWGMAE
TLAYASLVTKGHGVRISGEDSGRGTFSHRHAVLHDQKREKWDDGTYVPLRHMGEGMGEFL
VIDSILNEEAVMAFEYGFACSAPDKLTIWEAQFGDFANGAQVTIDQFLSSGETKWGRLCG
LTTILPHGYDGQGPEHSSARVERWLQLCSENNMQVIMPSEASQMFHLLQRQVLGSYRKPL
VIFMSKRLLRFKGAMSPLENFTEGSTFRPVIGDTAERASNDSVKRVALCAGQVYYDLEAG
RAERKLEDDVAIVRVEQLYPFPYDEVKAELAKYPNAKSVVWAQEEPKNQGAFYQIRHRIE
DVISEEQKLSYAGRPSSASPAVGYSSKHIAQLKQLVEDALAL
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgaaaaactcaatttctcttacctgttcggttcaaacgcaccttacattgag
gaattgtacgaggcttttttggaaaaccccgatgcggttgatgaaaaatggaagcagtat
ttcaccgatttgagcaaacagccggggacggttgctgtcgatgtcgcacacacaccgatt
cgcgaatcatttgttactttggcgaaaaagaaaattgcatctgccgttgcgggcggtgcg
gatgaggcaatgctgaaaaagcaagtcagcgttttacggctgatttccgcctatcgtatc
caaggcgtgggtgcagcccaacttgatccgctcaaacgtatccccccgcgcgatattgaa
gccctcgatccgaaattccacggtctgtcagatgccgatatggcgcttcaattcaatatg
ggcgagggcgattttgccaatcgcggcaaactgcctttgtcccaaatcatcagcaacctc
aaacaaacctactgcggccacatcgcattggaatatatctatattcccaataccgaagag
cgccgctgggtacgcaattattttgaaagcgtattgtccacaccgcattacaatgccgat
caaaaacgccgtatcttgaaagagatgactgctgccgagactttggaacgttatctgcat
accaaatatgtcggtcagaaacgtttcggtgtcgaaggcggcgaaagcgcgattgccggt
ttgaactacctgattcaaaacgccggtaaagacggcgtggaagaagtcatcatcggtatg
gcgcaccgtggccgtctgaatgttttggtgaacattttgggtaaaaaacccggagatttg
ttcgctgagtttgaaggccgtgccgaaatcaaattgcctagcggcgacgtgaaataccac
atgggcttcagctccgacatcgccactccacatggtccgatgcacgtttctttggcgttc
aacccgtcacacttggaaatcgttaacccggtagtcgaaggttctgcacgcgccaagcag
aaacgtttgggcgaaaacggccgcgataaagtcttgcccgtattgattcacggcgactcc
gcatttatcggtttgggtgtcaaccaagcgacattcaatctgtctaaaacgcgcggttat
accaccggcggtacggttcatatcgtcatcaacaatcaaatcggctttaccacttccgat
atccgcgatacccgttcaaccgtacactgtaccgatatcgcaaaaatggtttccgctccg
gttatccatgtgaacggcgatgatcctgagcgtgtttgctttgccatccaagccgctttg
gattaccgcaaaaaattccataaagacatcgtgatcgacgttgtctgctaccgtaaatgg
ggccacaacgagggcgacgatccgaccttgacccaaccgatgatgtacaaaaaagtatcg
caacacccgggtgcgcgtgctttgtacaccgagcaactgattgccgaaggcgtggtaacc
caagccgaggctgacggttacatccaagcctaccgtgatgctttggataaaggcgaacac
gtcgagcaaacaacgttgagcaacttccaacgcacacaaattgactggagcaaataccaa
ggtaaagattggcgcgaacacatcgaaaccgatttgcctgccgcggatattgagcgtctt
accgagaaatttaccgccgtaccggaaggctttgccctgcatccgactgcaaaacgtgtg
attgaagcgcgtaaagccatggcatccggcaaacaagccatcgactggggtatggccgaa
accttggcatacgcaagccttgtaaccaaaggtcatggcgtgcgtatctccggtgaggac
tccgggcgcggtacattctcacaccgtcatgcagtattgcacgatcaaaaacgtgaaaaa
tgggatgacggtacttatgttcctctgcgccatatgggcgaaggtatgggcgagttcttg
gttatcgactccattttgaacgaagaagccgtgatggcgttcgagtacggctttgcctgc
tccgcgcctgacaagctgaccatttgggaagctcaatttggtgacttcgccaacggcgcg
caagtgactattgaccaattcctgtcttcaggcgaaaccaaatggggtcgtttgtgcggt
ctgaccaccatccttccgcacggctacgacggtcaaggtcccgagcactcttctgcacgc
gtagaacgttggttgcaactgtgttctgagaacaatatgcaagtcatcatgccgtctgaa
gcgtcgcaaatgttccacctcttgcaacgtcaagtcttaggttcataccgcaaaccgcta
gtgattttcatgtccaaacgcctgttgcgattcaaaggggcaatgagcccgctggaaaac
ttcaccgaaggttcgactttccgtccggttatcggcgataccgccgaacgcgcaagcaac
gacagcgtgaaacgcgtggcattgtgtgccggtcaggtttactatgacttggaagccggt
cgagccgaacgtaaactggaagatgatgtcgctattgtccgcgttgagcagctgtatccg
ttcccatacgacgaggttaaagccgaactggcgaaatatccgaacgcaaaatctgtggtt
tgggcacaagaagagccgaaaaaccaaggcgcgttctaccaaatccgccaccgcatcgaa
gacgttatcagcgaagagcaaaaactgtcttatgccggtcgtccaagcagcgcatcgcct
gcagtgggctactcaagcaaacacattgctcaattgaaacaattggttgaagacgctttg
gcattgtaa

DBGET integrated database retrieval system