KEGG   Nakamurella multipartita: Namu_0826Help
Entry
Namu_0826         CDS       T00991                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
nml  Nakamurella multipartita
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(915012..916076)
Genome map
AA seq 354 aa AA seqDB search
MQLPVMPPVAPMLAKSVPDIPTGELSYEPKWDGFRSIVFRDGDEVEIGSRNEKPMTRYFP
ELVEAIKANLPPRCVIDGEIVVIVGDRLEFEVLQQRIHPAASRVRMLAEQTPASFVGFDL
LALGDTDYTGRPFAERRAALEQAMAGAAAPVHLTPATRDPALAAEWFEQFEGAGLDGVVA
KPLTGTYQPDKRTMFKIKHQRTADCVVAGYRVHKSGPDSIGSLLLGLYNDAGDLASVGVI
GAFPAARRKQLFTELQPLVTTFDEHPWNWAKPDESGARTPRSSEYSRWNVGKDLSFIPLR
PERVVEVRYEHMEGTRFRHTAQFNRWRPDRDPRSCTYEQLEEPVSYDLADILGR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcccgtcatgcccccggtcgccccgatgctggccaagtcggtgcccgacatc
ccgaccggtgagctgtcctacgaaccgaagtgggacgggttccgctcgatcgtcttccgc
gacggcgacgaggtggagatcggctcgcgcaacgagaaaccgatgacccggtacttcccc
gagctggtcgaggcgatcaaggccaacctgccgccgcgctgcgtcatcgacggcgagatc
gtggtgatcgtgggtgatcggctcgagttcgaggtgttgcagcagcggatccatccggcg
gccagccgggtccggatgctggccgaacagaccccggccagcttcgtcgggttcgacctg
ctcgccctgggcgacaccgactacaccggccgcccgttcgccgagcgacgggcggcgctg
gagcaggcgatggccggcgcggcggcgccggtgcacctgaccccggcgacccgggacccg
gcgctggccgcggaatggttcgagcagttcgagggggccgggttggacggggtggtggcc
aagccgctgaccgggacctaccagccggacaagcggaccatgttcaagatcaagcatcag
cggaccgcggactgcgtcgtcgccgggtaccgggtgcacaagagcggcccggatagtatc
ggctcgctgctgctggggctgtacaacgatgccggcgatctggcctcggtcggcgtcatc
ggcgcgttcccggccgcccgccgcaagcagttgttcaccgagctgcagccgctggtcacc
accttcgacgagcacccgtggaactgggccaagccggacgagagcggggcccggaccccg
cgcagttcggagtacagccggtggaacgtgggcaaggatctctcgttcatcccgctgcgc
ccggagcgggtggtcgaggtccggtacgagcacatggaaggcacccggttccggcacacc
gcccagttcaaccggtggcgcccggaccgggacccgcggtcgtgcacctacgagcagctc
gaagaaccggtcagctacgacctggccgacatcctgggtcgctga

DBGET integrated database retrieval system