KEGG   Nakamurella multipartita: Namu_4960Help
Entry
Namu_4960         CDS       T00991                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
nml  Nakamurella multipartita
Pathway
nml00250  Alanine, aspartate and glutamate metabolism
nml00280  Valine, leucine and isoleucine degradation
nml00410  beta-Alanine metabolism
nml00640  Propanoate metabolism
nml00650  Butanoate metabolism
nml01100  Metabolic pathways
nml01120  Microbial metabolism in diverse environments
Module
nml_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Namu_4960
   00650 Butanoate metabolism
    Namu_4960
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Namu_4960
   00280 Valine, leucine and isoleucine degradation
    Namu_4960
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Namu_4960
Enzymes [BR:nml01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Namu_4960
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Namu_4960
Amino acid related enzymes [BR:nml01007]
 Aminotransferase (transaminase)
  Class III
   Namu_4960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACV81233
UniProt: C8XA33
LinkDB All DBs
Position
5541361..5542659
Genome map
AA seq 432 aa AA seqDB search
MTELPGPKSRELFARRNSVVSAGVSTAFPVFIERAGGGVLVDVDGNSLIDLGSGIAVTSV
GNASPKVVQAVSEQVAAFTHTCFMVTPYEGYVQVCEQLAELTPGDHAKKSALFNSGSEAV
ENAVKIARHATGRTAVVAFDHAYHGRTNLTMALTAKNMPYKHKFGPFASDIYRVPTSYPF
RDAGVDGAAAAARAISQIAVQVGTENVAAVIIEPIQGEGGFVVPAAGFLPAVADWCKANG
IVFIADEIQTGFCRTGDWFACDREGVVPDLITTAKGIAGGLPLAAVTGRAELMDAVHAGG
LGGTYGGNPVACAAALGTIATMRELDLAGAARAIEETMTTRLRAIASRHPAIGDIRGRGA
MIAVELVKPGTTEPDAALTGAIAKACHAQGVVVLTAGSYGNVLRFLPPLVIGQDLLNEGL
DVIEAAFDQLAA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagctgcccggacccaagtcgcgcgagctgttcgcccggcgcaacagcgtcgtc
tcggccggggtcagcaccgcgttcccggtcttcatcgagcgcgccggtggcggcgtgctg
gtcgacgtggacggcaactcgctgatcgacctcgggtccggcatcgccgtgaccagcgtc
ggcaacgcatcgcccaaggtcgtgcaggcggtcagcgagcaggtcgccgcgttcacccac
acctgcttcatggtcaccccgtacgaggggtacgtgcaggtctgcgagcagctggccgag
ctgaccccgggcgatcacgccaagaagtcggccctgttcaactccgggtccgaggcggtg
gagaacgccgtcaagatcgcccggcacgccaccggccgcaccgcggtcgtcgcgttcgac
cacgcctaccacggccggaccaacctgacgatggcgttgaccgccaagaacatgccctac
aagcacaagttcggcccgttcgcctccgacatctaccgggtgccgacgtcctacccgttc
cgggacgccggcgtcgacggcgccgccgcggcggcccgggcgatcagccagatcgcggtc
caggtcggcaccgagaacgtcgccgcggtgatcatcgagccgatccagggtgagggcggc
ttcgtcgtgccggccgccggcttcctgccggccgttgccgactggtgcaaggccaacggc
atcgtcttcatcgccgacgagatccagaccggcttctgccgcaccggcgactggttcgcc
tgcgaccgcgagggcgtcgtgcccgacctgatcaccacggccaagggcatcgccggcggg
ctgccgctggccgccgtcaccggccgggccgagctgatggacgccgtgcacgccggtggc
ctgggcggcacctacggcggcaaccccgtcgcctgcgcggccgccctgggcaccatcgcc
accatgcgcgagctggacctggccggcgccgcccgggccatcgaggagaccatgacgacc
cggctgcgggccatcgcctcccggcacccggccatcggtgacatccggggccgcggcgcg
atgatcgccgtcgagctggtcaagccgggcaccaccgagccggacgccgccctcaccggg
gcgatcgccaaggcctgtcacgcccagggcgtggtcgtgctgaccgccggcagctacggc
aacgtgttgcgcttcctgccgccgctggtgatcggccaggatctgctgaacgagggcctg
gacgtcatcgaggccgcgttcgaccagctcgccgcctga

DBGET integrated database retrieval system