KEGG   Nitrosospira multiformis: Nmul_A1404Help
Entry
Nmul_A1404        CDS       T00302                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00500  Starch and sucrose metabolism
nmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nmul_A1404
Enzymes [BR:nmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Nmul_A1404
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Nmul_A1404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 EcKinase
Motif
Other DBs
NCBI-ProteinID: ABB74707
JGI: NmulA1404
UniProt: Q2Y964
LinkDB All DBs
Position
complement(1606903..1610205)
Genome map
AA seq 1100 aa AA seqDB search
MGREEDPLWYKDAIIYELHVKTFFDSNGDGIGDFSGLISKLDYLAELGVTALWLLPFYPS
PGRDDGYDISDYHNVHPDVGTLEDFHRFIAEAHSRGLRVITELVLNHTSDQHPWFQAARR
APPGSVKRDYYVWSDDNTKYSGARSIFTDTEGSNWEWDDVAQAYYWHRFFFHQPDLNFDN
PHVFNAMMHVMRLWLDAGVDGMRLDAMPYLCEREGTNCENLPETHAVIKRMRSELDKHYR
NRMFLAEANQWPEDVREYFGEGDECHMAFHFPLMPRMYMAIAREDRHPIVEIMEQTPDIP
ENCQWAVFLRNHDELTLEMVTDRERDYLHQTYAIDPQARLHLGIRRRLAPLMDNDRHRIE
LMNLLLMTMPGSPVLYYGDEIGMGDDLLLGDRNGVRTPMQWSGAVNGGFSTADSQRLFLP
AIIDPVYGFGAVNVDSQRRNSSSLLNWMKRLIAMRKAHRTFGRGTLRFLRPGNRKILAYL
REHEDETILCVANLSRVAQPVELDLSQFRGRVPVELMGRTPFPPVGELPYLLTLSAHGFY
AFRLTADVAAPAWHEERQVSPDLPVLVLVDSGWGTLLNRGEGNGGMKDLMARRARQQLEE
QIMPRFFYSQPWFLMRNLPVRKFELGEMHEWSAEQGSWLLATVVLTLANDETYRFAVPLA
LVWEDEDEAIVSTLLHATLAKVRRRERTGVLFDAFWDDGFCRAVISSMHEGSALLFKRGQ
VSFHATTAFPGPVVSGASTTVTRTVSERGRLFVNMGDRLVLKGYRWLLPGVHPELEMSRF
LTETAKFTHMAQLAGTVEYTDSEEGNSTLAILEHYAENQGSAWAYTQDYLQRYLDECRTQ
QKRPIDSRHIAYMTLINTLGLRTAEFHRALAQDDAEGAFGVEPITSEDLAQWASTVRAQM
DEMYKLLEAKWPDVPKSAQEAGNDLLSARSKFYRRITRLAAIHPQALKARCHGDYSLRQV
WLSNNDFLITNYGGGAERAWRERRWKQSPLRDVAGMLFSFSEVAAAALEHVTDEYPESTI
MLAQQADKWRVLASGDFLKSYRRAMKGNSLFPADAGVTDALVTLFMVEKAVASVSNALAQ
QSKAVDGTMQRLIRLMQHRR
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgggacgagaagaagacccgctctggtacaaggatgccattatctatgaattgcacgtc
aagacattcttcgacagcaatggcgacggcataggagacttttcgggcctgatttccaag
ctcgactatctggcggaactgggcgttaccgcgctctggcttcttccattttatccgtct
ccgggacgggatgacggttacgatatttccgattatcacaatgtgcacccggatgtcggc
accctggaggactttcaccggtttatcgcggaagctcacagtcgaggtttacgcgtaatc
acggaactggtgctcaatcatacttccgatcaacatccatggtttcaggcagcgcgccgc
gccccacctgggtccgtcaagcgcgactattacgtatggagcgacgacaacaccaagtac
agcggtgcacgcagtattttcacggacacagagggatccaactgggaatgggatgatgta
gcccaggcctattactggcaccgcttttttttccatcaaccggacttgaattttgataac
ccccatgtctttaacgccatgatgcatgtgatgcggctttggctggacgccggtgtcgat
ggcatgcggctggatgccatgccttatctgtgcgagcgtgaggggaccaactgcgaaaac
ctgccggaaactcatgcggtgatcaaacgcatgcgctccgaactggataaacactaccgc
aaccggatgttcctggctgaggcgaaccagtggccggaggatgtacgcgagtattttggc
gagggcgacgaatgccatatggctttccatttcccactcatgccgcgaatgtacatggct
attgcgcgcgaagatcgtcatcccattgtagagatcatggagcagacaccagacatcccc
gagaattgtcagtgggcagtgtttctgcgcaatcacgacgaactgacattggagatggtc
accgaccgcgagcgggattatcttcaccagacctacgcaatcgaccctcaggcccgcctg
catctcggtattcgccggcgtctggcgccgctgatggacaatgaccggcaccgaatcgaa
ttgatgaatctgctgctcatgaccatgccagggtcgcccgtgctctactacggagatgaa
atcggtatgggtgatgaccttctcctcggtgatcgaaatggggtgcgcacgcccatgcag
tggtcgggtgcagttaacggcggattttcaacggctgattctcaacggcttttcctgccg
gccatcatcgaccccgtatatgggtttggggcagtgaacgtggactcacagagacggaat
tcgtcatccctgctcaactggatgaagcgcctgattgcgatgcgcaaggcacaccggacc
tttggccggggcacgctgcgttttttacggcctggcaatcgcaagattcttgcttatctg
cgtgagcatgaggatgaaacgattctgtgcgtggctaatctgtcccgcgtcgcgcagccg
gtagagctggatttaagccaattcaggggaagggtaccggttgaattgatggggcgcacg
cctttcccacccgtgggtgagctgccgtatcttcttaccttgagcgctcatggcttttat
gcttttcgcctgacagccgatgtggccgcccctgcctggcatgaggagcggcaggtatcg
ccggatctgcctgtccttgtgcttgtggattcgggttggggcaccctgttgaaccggggc
gagggtaacgggggcatgaaagacctgatggctcgtcgtgcccgccaacagctcgaggag
cagatcatgcctcgcttcttttattcccaaccctggtttttgatgcgaaatctccccgtc
agaaaatttgagctgggggagatgcacgagtggtccgcggagcagggaagctggctgctt
gccaccgttgttttaacgctggccaatgatgagacttatcgctttgccgtgcctttggca
ctggtgtgggaggacgaggatgaggcgattgtgagcacgctgctgcatgccacgcttgcc
aaggttcgccgccgggagcggacgggcgtgctgttcgacgccttctgggatgacggcttc
tgccgcgccgtgatctccagcatgcatgagggttccgcactcctgtttaagcgggggcaa
gtatctttccatgcgaccaccgcttttcccggcccggtggtttcaggcgcgtcaacaacg
gtgacccggacagtttcggagagagggcgattgttcgtgaacatgggcgaccggctggta
ctgaaaggataccgctggcttcttcccggcgtgcatcccgagctggagatgtcgcgtttt
ctgacggagacggcaaaatttacccacatggcgcaactcgccggcaccgtggagtacacg
gacagtgaggaaggcaattccactctggcaatcctcgagcactacgccgagaatcagggt
agcgcctgggcttatacacaggactatctgcaacgctacctggatgaatgccgcacacaa
caaaagcgtcccattgattcgcggcatattgcctacatgaccctcatcaatacgctggga
ttgcgtacggcggaatttcaccgggcacttgcgcaggatgatgcagagggagctttcggc
gtcgagcccattacctccgaagatcttgcgcagtgggcgagcaccgtgcgtgcgcagatg
gatgaaatgtacaaattgctggaagcgaaatggccggatgtacccaaatccgcgcaggag
gccggcaacgatcttttatcagcccggtcgaaattctaccgtcgtatcacccgccttgca
gccatacatccccaggccttgaaggcgcgttgtcatggggattacagcctgcgtcaggtg
tggctctcgaataatgattttctgattacgaattacggcggcggtgccgaacgcgcatgg
cgtgagcgccgctggaaacagagtcccctccgcgatgtggcaggtatgctgttttcgttt
tccgaggtggcggcagcggcactggagcatgtcacggatgaatatccggaatcaaccatt
atgcttgcacaacaagctgataaatggcgagtgcttgccagcggcgatttcctcaaaagc
tatcgcagggcgatgaagggaaattccctgttccccgctgatgccggagtaaccgatgct
ttggttacgctcttcatggtggagaaagctgttgccagcgtgagtaacgcgctcgcgcaa
caatcgaaggcagtcgatggaaccatgcagcgactgatacggctgatgcaacacagaagg
tag

DBGET integrated database retrieval system