KEGG   Nitrospira moscoviensis: NITMOv2_2463Help
Entry
NITMOv2_2463      CDS       T04041                                 

Definition
(GenBank) putative Multi-domain non-ribosomal peptide synthetase
Organism
nmv  Nitrospira moscoviensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2280970..2290257)
Genome map
AA seq 3095 aa AA seqDB search
MAISEGAPGSSNQPGRFSGVPPGETLVDVVRWRARHEPERPAYLFIKQGIEVDDRLTYGE
LHRRAYVLAGWLQRHARREDRALLVYGGGLDVAVAFWACLYAGIIAVPAPPPDPVSLKRR
IPRLKRIAEDSDACLVLSSGAALDHVRALSADLGLPPGCRIVDTSAVSPQWAGDMAVHRS
AETDLAFVQYTSGSTADPKGVMVAHGNLLVQCRDLHAAAGSTEHSRSLTWMPYFHDYGLI
HGLVAPVFAGHPSYLMPALLFLKEPVRWLEAMTAHGITHSGAPNFGYEHCLRGIEPAQRT
ALNLARWNVASCGAEPIREATMAGFIDAYRPYGFRPEAFSPAYGMAECTLVVSLKAYGVP
PTVSRLDTECLQQGRIAKAEGAGSLRAVVGCGMPIGDMQVVIVNPDTRERCAPDVVGEVW
LSGGSVARGYWNRPADTDAVFRAFISGTGEGPFLRTGDLGFLQDGQLFITGRLKDLIIVH
GRNHYPQDIELTVEFCHPALRPGGGAAFAVEGPLGEQLVVVQEVQRLAKPVDGENICSHI
RRHVADEHELHVFEVVLIKAGSLPKTSSGKVQRRACRDAYLGDRLPIVGRSRAPGSVLRE
QPRAVSEPTSALPPETGEAAAAEASIRDILAEQLKVVPEQIRADAPLAAFGLDSLMVSIL
RNRLEQRYGVSPSFAQIMSEWTVRDLARHMVIHGRRPPADHGDSETDGLICGALRPLSAN
QRRIWFLEQIYPGTAMNNISVGIRLRGAIDVAALERCVAALASRHDMLRARFIGNDREVM
ARIEPDGMIAVERYLVEPEATDVERLFSRLAKEQVARPFDLEKGPLCRVFLATGSPTDHL
LVVTAHRLIADGWSLRLFCREFTELYHAGEGIAVPVPPACAQAYAAYVDWQEAWLAGPDR
EVQEAYWKSRLTDLPPPVEVPADYPRVDRPGPRNSQVRNRLLPPDLASALNRFCQDHAVT
KFMVGYAALAAWLWRCTGAEDAVVGSVVANRRRTRFERAFGYFVNTVALRLNAAEAGTGR
ELLGRVKQVVTEAYDHQDVPFETVLDAVKMRRDARRPLFNVMLVLEDDPVAELLLPGVTA
TALPVEVPALECDLVVMMLAGPKGTELALAYDADLFTADTATRMLAQLETVLAGMIRQPD
ARLSSLPLLSEQERRTVLVEWNRTQAPLSGMRCIHLEIAAQAERTPDAAAVICGSDTLTY
GELNRQSDRLASVLAGMGIGRGHRAVLICERSAAGIIALLGVLKAGAAYVPLDPTWPDQR
IRSMCEDANPSVIVTHRELRERVRDYGRKVLTLDALDVSHAQTVPAIERTSLDDVAYVVY
TSGSTGKPKGVQISHRSLRSSLDARVRYYHEPVDRFLLTFPFAFDGSVTGIYWTLLQGGA
LVIPSEAAHRDPTHLRELIGRHRITHLVAVPSLYEAVLRGVSASKVASLRVVISAGETLS
PQLVRRHYEVAPGAALYNEYGPTEATVWCTVYRTTPGESAARVPIGKPIPNVQVYVLDAR
LQPVPVGMPGELYVAGAGLALGYLNEPALTDAKFVPHPFEPQAKVYRTGDLARFRSDGNL
EFLGRADHQVKLRGYRVELEEIDAVLRAYPGVDEAVAVLREDTPGQQRLVAYYTGALEQD
AEGPLRTYAASRLPSYMVPALLIHVDTLPRTAAGKVDRRRLPAPHDVDSGPRPADAPSTP
TEAALIQIWKEILHLPQVGVDDNFFQLGGHSLLATQVVSRVRETFRVDCPLRTVFELPTI
AELADAIDRLRQEAPATAGAAVVPVPRDRPLPLSFSQQRMWFMYQLSPESTAYNMPIATR
LLGPLDREAMLAAAHDMVRRHEAFRTTFSLTPDGPTQQIHGAQPVDVHDVDLRGMPMDVR
VAEAARLVAEEARRPFDLHRGPLARFSLIRIDEADHILVLNMHHIIGDQWSFGVIGRECA
RLYNEYRRGRRPVSEHAALQYADVAVWQRRTLTDTALAGQLAYWREKLAGLPVLTLPTDY
PRPQRQSFVGSYRSMELPEALLARLRTVCAEQGGTLFMGLLAAFQILLSRYSGQDDIAVG
VPIANRTRRFTEDIIGTFVNTLVMRTDLSNRPSFTEAVGRVRDSALGAYAHQDLPFERLV
SAVAPGRDLSHSPLVQVLFNVANAPLGRIEFDGLTWAPFEFDGGTVQFDLTMTIDTEVSR
KVYLSYRTDLFTGETVERMVREYVALLEAVAADPHRTITEYDCMSPADRRRLLIEWNRTE
ADYPSNLSLPELITAQAARTPDAVAVAQGAHRLTYGALERRANQLAHYLRRRGARPGACV
GICLERTPSLLVGALGILKSGAAYIPLDPEYPLDRLHYMLEESGAGLVVTSQALKSRLPE
TGREVICLDREQRTVEQESMQAPAAPEPSDLAYVLYTSGSTGKPKGVAICHRSLVNFLWS
MKSVPGCSSRDRLLAVTTLSFDIAGLELYLPLIVGGTVELVDRRTATDGHALKALLKNSR
STIMQATPATWRMLIDAGWEATPDLTVLCGGEALSRDLADRILERAGSLWNMYGPTETTI
WSTVSPVARGDAEITIGRPIANTQLYVLDAALRPVPIGVPGELYIGGEGLALGYHRRPDL
TAERFIASPFNPAARLYKTGDLVRYRSDGHVVHLGRLDHQVKIRGFRIELGEIEAALLRH
PVVRQAVVGARPDASGTKQLVAYAVLKQDAGFDVREMHTFLRRSLPDYMVPAHLVVMPQL
PLTANGKVDVSALPVPDPPPRSHAGPSGRPMTPVQVQLAALWQQVLGVPDIGIHDNFFDL
GGHSLKAVQLFAHLERVFGKQLPLATLFQAPTIAQLSDILTASQWEAPWRSLVAIQPAGA
APPVFAVPGVGGNVLGFAKLAQLLGPDQPFYGLQTRGLDGREAPFTSIVNMAAHYVEEIR
TIQRNGPFVIAGTCTGGVVAYEMAQQLSAVHEPVILMILESWHPLSYNGYALRMKRYARP
LLYGWSRALRFLGSSRRLSLSERVRLGLSNLIRRVERIGSASAAPILGEEFSNQRVAGAT
LEAVASYRPQEYRGRLLNVTASKRVVDDPARDTRTLWEFLARGGAESAGIPAGNSGQLFV
SPHVEALADLLRDYIRKERSLRAAAHDRTVTNDRA
NT seq 9288 nt NT seq  +upstreamnt  +downstreamnt
atggcaataagtgaaggtgcgccaggatcgtcgaatcagcccggccggttcagcggtgtg
ccgccgggtgaaactctcgtcgatgtcgtgagatggcgagcccggcacgagccggaacgt
cccgcctacctcttcatcaagcaaggcatagaagtcgatgatcgcctgacgtacggcgag
ctgcatcgacgggcctatgtgctggccgggtggctccagcggcatgcccgacgggaggat
cgggcgcttctggtgtatggcggtggattggatgtcgccgtggccttctgggcctgcctg
tatgccggcatcatcgcggtgccggcgcctcctcccgatcctgtcagcctcaagcgacgg
attcccagactgaaacgcatcgccgaggacagcgacgcctgcctggttttgagcagcgga
gcggcgctcgatcatgtacgcgcgctgtccgcagatctcgggttgccgccgggatgccgg
attgtcgatacgagcgcggtgtccccgcagtgggccggtgacatggccgtccatcgatcg
gcggagacggatctcgcgtttgtgcaatacacgtccggctcaaccgcggaccccaagggc
gtgatggtggcccacgggaacctcctcgtccaatgccgggaccttcacgccgcggcgggg
agcaccgaacacagccgcagcctgacctggatgccgtactttcacgattatggactgatt
catggacttgtggcgccggtctttgccggacatccctcctatctgatgccggcgctactg
tttctgaaagagccggtccgatggctcgaagcgatgaccgcccacggcatcactcacagt
ggcgcgcccaacttcggttacgagcattgtttgcgcggcatcgagccggcgcagcgaacg
gcgttgaacctggcccgttggaatgtggcgagctgcggcgcggagccgatccgtgaggcg
acgatggccggattcatcgacgcgtatcgaccttatggattccggcccgaggcctttagc
cccgcctacggcatggccgagtgcacattggtcgtgtcactgaaggcgtacggcgtgccc
cccacggtctccagactcgacacggaatgtctccagcaaggtcggattgcgaaggccgag
ggcgcgggaagcctccgtgcggtcgtcggctgcggcatgccgatcggcgacatgcaggtg
gtcattgtgaatccggacacacgggagcgatgtgcgcccgatgtggtgggcgaagtgtgg
ctgtccggaggaagcgtggcgcggggatactggaatcggccggccgacaccgatgcggtc
tttcgcgcgttcatctccgggaccggcgagggaccgttcctgagaaccggcgatctcggc
tttctgcaggacggccagctgttcatcaccgggcgattgaaggatctcatcatcgtccac
ggacgaaatcactatccgcaggacatcgagttgaccgtggagttctgccacccggcgctg
aggcccggcgggggtgcggcctttgcggtcgaaggtcccctcggtgagcagcttgtggtg
gtgcaggaagtccagcggttggccaagcccgtcgatggagaaaacatctgctcgcatatc
cggcgtcacgtcgccgacgagcacgagctgcatgtcttcgaggtggtgctgatcaaagcc
ggaagtcttccgaaaacctcgagcggaaaagtgcaacgtcgcgcctgccgggacgcttat
ctgggagaccgcttgccgatcgtcggcaggagccgagcgccgggatcggttctgagggaa
cagccgcgcgcggtttccgaaccgaccagtgcgctcccgcccgaaaccggcgaggcggcg
gcagccgaagcgtcgatccgcgatattctcgcggaacaattgaaggtcgtccccgagcag
attcgcgccgatgcgccgttggccgctttcgggctggattcgctgatggtcagcattctg
cggaaccggttggagcaacggtacggcgtcagtccgtcgttcgcccagatcatgagcgag
tggaccgttcgggatcttgcccggcatatggtgatccacggcaggcggccaccggcggac
cacggcgacagcgagactgatggactcatctgcggtgcgctgcggccgttgtcggccaac
caacggcgcatttggtttctggagcaaatctatcccggcacggcaatgaacaatatttcc
gtcggcatccggctgcgcggcgccatcgacgtggcggccctcgagcgctgcgtggccgcg
ctcgccagccgccatgacatgctgcgcgcccgatttatcgggaacgaccgggaggtcatg
gccagaatcgagccggatggaatgattgccgtcgaacggtacctcgtcgagccagaggcg
acggatgtcgaaaggctgttcagccggctggcaaaggagcaggtcgccagaccgttcgat
ttggaaaaaggaccgctgtgtcgagtgttcctcgctaccggttccccgacagaccatctt
ctggtggtgacggcccatcggttgattgccgacggctggtctcttcgattgttctgccgc
gaattcaccgagctatatcacgcgggagagggaattgccgttccggtgccaccggcctgc
gcccaagcctatgcggcctacgtcgactggcaagaggcttggcttgccggtcccgaccgt
gaagtgcaggaagcctactggaagagccgattgaccgatctcccgccgccggtcgaagta
ccggccgattatccgcgggtggatcgaccggggcccaggaacagtcaggtgcgcaaccgt
cttctgccgcccgatctggcatccgcgttgaatcgattctgccaggaccatgcggtgacg
aaattcatggtgggatatgccgccctcgccgcgtggctctggcgctgtaccggcgcggag
gatgcggtggtcgggtcggtcgtggccaatcggcggcgcacccggtttgaacgcgcgttc
ggctatttcgtgaacaccgtcgcgctcagactcaatgccgccgaggcaggcacgggtcgc
gagttgttgggccgcgtcaagcaggtcgtcacggaggcgtacgatcatcaggatgtgccg
ttcgaaaccgtgttggatgccgtgaagatgcggagagatgcgcgccgcccgctgttcaac
gtcatgctcgtcctcgaagacgatcccgtggccgagcttctgctgccgggcgtgacggcg
acggccttgccggtggaggttccggcactggaatgcgacctggtcgtgatgatgttggca
gggcccaaaggaacggaactggccctggcctacgatgccgatctcttcacggccgacacg
gcgacccggatgctggctcagctggaaacggtgctggccggcatgatccgacagccggat
gcccgtttgtcttccctgcccctcttatcggaacaggagcgacggaccgtcctggtggag
tggaaccggacgcaggcgcctttgtccggcatgcgttgtatccatcttgaaatcgcggcg
caagcggaacggacgccggatgccgcggcggtcatctgtggttcggacaccctcacttat
ggcgaattgaatcggcaatccgatcgactggcgtccgttctggccggcatgggaatcggg
cggggccaccgagcggtattgatctgcgaacgctcggccgccggcatcatcgcgttgttg
ggcgtattgaaggccggcgccgcctatgtgccgctcgatccgacgtggcccgatcagcgc
atccgttcgatgtgtgaagacgcaaacccgtccgtcatcgtcactcatcgggaactgcgc
gaacgcgttcgagactacggccgaaaggtactcacgctcgacgcgctcgatgtcagccat
gcgcagacggtgcccgccatcgaacgaaccagcctcgatgacgtggcctatgtggtctat
acttccggttcgacgggaaagcccaagggagtccagatttcacaccggtcgttgcggtcg
tcgctggatgcccgcgtgcggtattaccacgagccggtggaccgttttctgctgacgttt
ccgttcgctttcgacggctcggtgacaggcatctactggacgctcttgcagggcggcgct
ctggtgattccctccgaggcggcacaccgggatccgacccacttgcgcgaattgatcggc
cggcatcggatcacccacctggtggcggtcccgtcgttgtatgaagccgtcctgcgcggg
gtgtcggcttcgaaggtggcctcactccgcgtagtgatttccgcgggagagaccctgtcg
ccccagctcgttcgccggcactatgaggtcgcgcccggagcggccctgtacaacgaatat
gggcccaccgaagcgaccgtctggtgcacggtctatcgaaccacgcccggcgagtccgcc
gcgcgtgttccgatcggaaagcccatccccaacgtccaggtgtacgtgctcgatgcccgc
ctgcagccggttcctgtcgggatgcccggtgagctatacgtggcgggcgccggcctggct
ctcggctatctcaatgaaccggcgttgaccgacgcgaaattcgtgccccatccattcgag
ccgcaggcgaaggtctatcggaccggcgacttggcgcggtttcgttccgatggaaatctg
gaattcctcggccgcgccgatcatcaagtcaaactgcgggggtatcgcgtcgagctcgag
gagatcgacgcggttctccgtgcctaccccggcgtcgacgaggcggttgcggtgttgaga
gaggatacaccggggcaacaacggctggtcgcctattacaccggcgcgcttgagcaggat
gcggaagggccgttgcggacgtatgcggcgtcgcgcctgccttcgtatatggttcccgcg
ctgctgatccacgtagacaccttgccgcggacggccgccggcaaggtcgaccggcgtagg
ctaccggctccgcacgatgtggacagcgggccccggccggccgacgcgccgagcaccccc
accgaagcggcgttgatccagatatggaaagagatccttcatcttccacaggtgggcgtg
gacgacaatttctttcaattgggagggcactcgttgctcgcgacccaagtcgtgtccaga
gtgcgggagacgtttcgggtcgactgccccctgcggacggtgtttgagcttcccacaatc
gccgagttggccgacgcgatcgatcggctccgccaggaagccccggcgacggcaggggcg
gcggtggttccggtcccccgcgatcgcccgttgccgttgtcgttctctcagcagcgcatg
tggttcatgtaccagctgtcgcccgagagtacggcctacaacatgccgatcgcgacgcgc
ctgctcggtccgctggaccgggaggccatgctggccgccgcgcatgacatggtgcgacgt
cacgaggcctttcggacgaccttcagcctgacgccggacggtcccacacaacagattcat
ggcgcgcagcctgtcgacgtgcacgacgtggatctgcgcggcatgcctatggacgtccgg
gtggcggaggccgcacgcctggtagccgaggaggcgcggaggccgttcgatcttcaccgg
ggtccgctcgcgaggttcagtctcatccggatcgacgaggcggaccatattctcgtgctg
aacatgcatcacatcatcggagatcaatggtcgttcggcgtcatcggtcgggagtgtgcg
cggctgtacaatgaatatcgccgggggcgccgtccggtctcggagcacgccgcactgcag
tatgccgacgtggcggtgtggcaacgccggacattgacggacaccgctctggccggccag
ttggcctattggcgcgagaagttggccggactgccggtgttgaccttgccgaccgactat
ccgcgcccgcaacgccagagctttgtcggctcgtaccgatccatggagctccccgaggcg
ttgctggcgcggctgcgcacggtttgcgccgaacagggcggcacgctgttcatggggctg
ctggcggcgtttcagattctcttgagccgctactccgggcaggacgacatcgccgtcggg
gtgccgatcgccaaccgcactcgacggttcacggaagacatcatcggaaccttcgtgaac
acgctggtgatgcggacggatttgtctaatcggccctcgtttacggaagcggtcggccgc
gtgcgggacagcgcgctcggcgcgtatgcccatcaggatttgccgttcgagcgcctggtg
agcgccgtggcgcccggacgcgatttgagccactctccgctggtgcaggtgttgttcaac
gtggcgaacgcgcccctcggccgcatcgagttcgacgggttgacgtgggcgccgtttgaa
ttcgacggaggcaccgttcagttcgatctgacgatgaccatcgacaccgaggtgtcccgg
aaggtctatctgagttaccggaccgacttgttcacaggagagaccgtcgagcggatggtc
cgggagtatgtcgccttgctcgaagccgtcgcggccgacccgcatcggacgatcaccgag
tacgactgtatgagtcccgccgatcggcggcgtctgttgatcgaatggaaccgaaccgag
gcggactatccgtccaacctgtcgttgcccgagttgatcacggcgcaggccgctcggacg
ccggacgccgtcgccgttgcacagggcgcgcaccgcctgacgtatggggcgttggagcgc
cgcgccaatcagcttgcgcactatctgcgccggcgaggggctcggccgggcgcctgcgtg
gggatttgcctggagcggacgccgagcttgctcgtgggcgccctgggcatcctgaaaagc
ggggccgcctatattccgctcgatcccgaatatccgctcgaccgcctccactacatgctg
gaggagtccggcgccggcctcgtggtcacatcgcaggcgctgaagtcccggctgcccgag
accggcagggaagtgatctgcctcgatcgtgagcagcgcactgtggagcaggaatccatg
caggctccggcggcacccgagccgtccgacctcgcctatgttctgtatacatccggatcg
accggcaaaccgaagggcgtggcgatctgccatcgctcgctggtcaatttcctctggtcc
atgaaatccgtccccggctgttcgtcacgcgaccgcctgctggccgtcacgaccctgtcg
ttcgacattgccgggctggagttgtatttgccgctgatcgtcggcggaacggttgaattg
gtcgaccgccgcaccgcgaccgacggccatgcgctgaaggcgctgctgaagaactcgcgc
tccaccatcatgcaggccactccggcgacctggcggatgctcatcgacgccggctgggag
gcgactcccgacctaacggtattgtgcggcggcgaagccttgtcgcgagatctggccgat
cgcatcctggagcgggccgggtcgctctggaatatgtacgggccgaccgaaacgaccatc
tggtcgacggtgtcgccggtggcgcgcggcgacgcggagatcaccatcggccggccgatc
gccaacacgcagctctacgtgctcgatgcggctctccgccccgtgcccatcggcgtaccg
ggagaactctacatcggcggggaggggctggcgctcggctatcaccggaggccggacttg
accgccgaacggttcatcgcgtctcccttcaatccggctgcgcgcctctacaagaccggc
gatctggtgcgctatcggtcggacgggcacgtggtgcacttgggacgattggaccatcag
gtcaagattcgaggattccgtatcgaactcggggagatcgaagcggcgttgctccggcat
cccgtggttcgccaggccgtggtcggcgccaggcctgatgcgtcgggcaccaagcagctc
gtggcctatgcggtcctgaaacaggatgccggtttcgacgtgcgcgagatgcacaccttc
ctgcggcgaagcctgccggactacatggtgcccgctcatctcgtcgtcatgccgcagttg
ccgctgacggccaatggcaaggtcgacgtctcggcgctgccggttccggacccgccaccc
cgatcgcatgccggcccgtccgggcggcctatgacgccggtccaggtccagttggcggcc
ttgtggcagcaggtgctgggcgtgccggacatcggcatccacgacaattttttcgacctg
ggagggcattcgctcaaggccgtccagttgttcgcgcatttggagcgggtgttcggaaag
cagttgcccttggcgacgctgttccaggcacccaccatcgcgcagctgagcgatatcctg
accgcctcgcagtgggaggcgccgtggcgttccctggtcgccattcagccggcgggggcg
gcccctcccgtttttgccgtgccgggcgtgggcggcaacgtcctgggattcgccaagttg
gcacaattgctgggaccggaccagccgttttacggtttgcaaaccaggggactcgacggt
cgggaagccccctttacgtcgatcgtcaacatggcggcgcactatgtggaggagatccgc
acgattcagcggaacggccctttcgtcatcgcgggcacgtgcaccggcggcgtggtggcc
tatgaaatggcgcagcaactgtcggccgtccatgaaccggtgattctgatgattctggaa
tcctggcacccgctgtcctacaacggctatgccttgcggatgaaacggtacgcgcggcct
cttctctatggatggagccgcgccttgcggtttctgggctcctcccgccggttgtccctg
tcggaacgggtgcgcctggggctctcaaacctgatccggcgagtggagcgaatcggatcg
gcgtcggccgcgccgattctgggagaagagttcagcaatcagcgcgtcgcgggagcgacg
ctcgaagccgtcgcctcgtatcgtccacaggaatatcgggggagattgctcaacgtcacg
gcgtcgaagcgggtggtcgacgatccggcgcgggatacgaggacgctgtgggaatttctc
gcccgcggcggcgccgaatcggccggcataccggccggcaattccggtcaattgttcgtc
tcgccgcacgtcgaagcgttggcggaccttctgcgggactacatccggaaagagcggtcg
ttgcgggccgccgcgcacgaccgcaccgtgacgaatgatcgcgcttag

DBGET integrated database retrieval system