KEGG   Nitrospira moscoviensis: NITMOv2_2805Help
Entry
NITMOv2_2805      CDS       T04041                                 

Gene name
sod
Definition
(GenBank) Superoxide dismutase (Fe)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nmv  Nitrospira moscoviensis
Brite
Enzymes [BR:nmv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NITMOv2_2805 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2651460..2652095)
Genome map
AA seq 211 aa AA seqDB search
MQRDKPYKVKSFNLHGLQGISDRTLEMHFSLYEGYVKAANALTNDIGEFLKDGRVDQEEM
PAYSELTRRLGFEYNGMVLHEYYFGNLTKEAAAKPPSDSAFLRAAEESFGSYDRWKTDFV
SVGKMRGVGWAICWQHPAGGRLSNQWTTLHEHGNVAGFIPILIMDVWEHAFLLDYPPSKR
GDYIEAFFTNIDWKAVDRRLTGEQARQAQAA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgacaagccatacaaagtgaaatccttcaatctgcacgggctgcagggcatt
tcggaccgcacactcgagatgcatttctccctgtacgaaggatatgtcaaggcggcgaat
gcgctcacgaacgacatcggcgagttcctcaaggacggccgcgtggaccaggaagagatg
ccggcctactcggagctgacgcgccggttgggtttcgaatacaacggcatggtgctgcat
gaatattatttcggcaacttgaccaaagaggccgcggcgaagccgccgagcgattccgcc
tttctgcgcgccgccgaagaatccttcggctcttacgaccgctggaaaaccgatttcgtc
agcgtgggcaagatgcggggcgtgggctgggcgatctgctggcagcatccggccggcggc
cggctctcgaaccagtggacgacgctccacgagcacggcaacgtcgcgggcttcattccc
atcctcatcatggacgtgtgggagcacgcctttctcctcgattacccgccgtcgaagcgc
ggagactatatcgaggccttcttcaccaacatcgactggaaagcggtggatcgccgcctc
accggcgaacaggccaggcaagcgcaagcggcgtaa

DBGET integrated database retrieval system