KEGG   Nocardia nova: NONO_c61610Help
Entry
NONO_c61610       CDS       T03032                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
nno  Nocardia nova
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6635511..6636986
Genome map
AA seq 491 aa AA seqDB search
MSDRLMFRREFFVGGAWVPPTSDERFPVISPSTEEVVGEVPVATTADIDRAVDAARIAFD
GGPWPRMSPAERADALTRAAKILRSREADIAAITVDEIGCPVSQSRQAQTGMVAALFDYY
AGLIREFDFEQTVTAGDRCGLVTREPVGVVAAVVPWNAPVTLAAWKTAPALAAGCTVVLK
PPPESPLSNFVLAEALEAAGIPSGALNVVPGGREVGEYLVTHPGTDKVAFTGSTAAGKRI
MSVCGDQVKRVSLELGGKSAALVADDADIGTVLPAIVKGAMHMSGQVCGAHTRVLLPRAR
YDEAVEAAAAAAAAVRIGDPHDPATLVGPLVAERQRTRVEHYIALAREAGARVVTGGGRP
AAPAKGWYVQPTILSEVDNSMRVAREEIFGPVLCLIPYGDDDEAVRIANDSPFGLSGGVW
TGAPERGLALARRLRTGSIAINGTYPPFPHVPFGGFKESGLGRELGVDGLHSFLEPRSIG
LPAALRPGGER
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatcgattgatgttccggcgggagttcttcgtcggcggcgcgtgggtgccgccg
acgagcgacgagcggtttcccgtgatctccccgtcgaccgaggaggtcgtgggcgaggtg
ccggtggcgaccaccgccgatatcgatcgcgcggtcgacgcggcccgcatcgccttcgat
ggagggccgtggccgcgtatgtcaccggcggagcgggccgacgcactgacccgcgccgcg
aaaattctgcgctcccgcgaggccgatatcgcggcgatcaccgtagacgagatcggttgt
ccggtcagccaatccaggcaggcacagaccggcatggtcgcggcgctgttcgactactac
gccgggctgatccgcgaattcgacttcgagcagaccgtcacggccggtgaccggtgcggt
ctggtgacccgggaaccggtcggcgtcgtggccgccgtcgtcccgtggaatgccccggtg
accctggccgcgtggaagaccgcacccgcgctggccgccgggtgcacggtggtgctgaaa
ccgccgccggaatcgccgctcagcaacttcgtgctggccgaggcgctcgaggcggccgga
atcccgtccggggccctcaatgtcgtgcccggcgggcgggaggtcggcgaatatctggtc
acccatcccggcaccgacaaggtggccttcacgggatcgacggcggccggtaagcggatc
atgagcgtctgcggcgaccaggtgaagcgggtatcgctcgaactcggcggcaaatcggcc
gctctcgtggccgacgacgccgatatcgggaccgtcctgcccgcgatcgtcaagggcgcg
atgcatatgtccgggcaggtctgcggtgcgcacacccgcgtcctgctcccccgcgcgcgc
tacgacgaggcggtcgaggcggcggcggccgcggcggcagccgtccggatcggcgacccg
cacgaccccgcgacattggtcgggccgctggtggccgaacgtcagcgcacccgcgtcgag
cactacatcgcactggcccgcgaggcgggtgcgcgggtggtgaccggcggcgggcgtccc
gcggccccggcgaagggctggtatgtgcagcccacgatcctgtccgaggtcgacaattcg
atgcgagtggcgcgtgaggagatcttcggccccgtcctgtgcctgatcccctacggcgac
gacgacgaagccgtgcgcatcgccaacgactcccccttcggcctgtccggcggggtgtgg
acgggcgcccccgagcgtggccttgccctcgcgcgacggctgcgcaccggcagcatcgcg
atcaacggcacctacccgccgttcccgcacgtgcccttcggcggcttcaaggaatccggt
ctcggccgcgaactgggcgtcgacggcctgcacagtttcctcgagcccaggagtatcggc
ctgcccgccgcactgcggcccggcggcgaaagatga

DBGET integrated database retrieval system