KEGG   Nocardia nova: NONO_c74330Help
Entry
NONO_c74330       CDS       T03032                                 

Definition
(GenBank) non-ribosomal peptide synthatase/polyketide synthase
  KO
K12436  
polyketide synthase 12
Organism
nno  Nocardia nova
Brite
Lipid biosynthesis proteins [BR:nno01004]
 Polyketide synthase
  Modular PKS
   NONO_c74330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
8092822..8106624
Genome map
AA seq 4600 aa AA seqDB search
MPGPISSQDATGGVMYRSIVDVLATWSSLRPDRVAYRYLETGDVDGATSTLTYAQLERRA
HSVAERLREGGFTGERALLLYPPGLEFVPGFFGCAVGSVVAVPAPLPQLHELSRSLRRLR
QIVADAEIRCVLTTRAVVDLLGAVVAELPELAAMTWIATDEIDISTAAAFDTPRIDPDSV
AFLQYTSGSTSAPRGVIVSHRNLLHNEQAIAETFGHTADLVDNWQGDLFLSWLPVFHDMG
LIGPILHTVYLGTTVTLLSPLHFLEKPERWVTAMSAFGAHSSGAPNFGYEIAARRATPEL
VERLDLSRWRVAFNGAEPIRAETLRRFADTFGPAGFRSESFLPVYGLAEGTLLVSGSGGI
DRAPSVIERAKPGEAGTPWVGSGRAPEGISIVIVDPETRIRCADGEVGEIWTASDSVADG
YLGHPELTEAVFRATLTDGSGPYLRTGDLGFLSDGELFVTGRAKDVLIIDGRNHYPQDLE
ASVEAAHATVRAGCVAAFSVEGADGERPVVVAEVKTTDADELAAAEMAVRAVLGTEHGLA
PHAIEFVAPRTILKTSSGKIQRQACRAAYLAGELSLVAPKQAAKSGPDTQSVSATTTVTA
AATGYDRESVTAWLIDAVAAHTHLDASRIDVHRPLSEFGLGSRGLVELVTELSEHLGRTV
DPAMVFEHPTIAQLAAALRPGEVVSEATGERDLSGEPIAIVAMACRLPGGVDDPEALWQL
LSGGRDAITEAERWRTEALYDPDPEAVGKAYTLRGGFLDDIDLFDAAFFGIGPREAAAMD
PQQRLLLQLSWEVVERSGRDPRTLEGTSTGVFLGLYGSGYLAGAGPDQMNGHLGTGSALS
VASGRIAYSLGLHGPALTVDTACSSSLAALHLAIRSLRAGECDNALVGGATLLVSPNGHV
EFSKLGVLSPSGRTAAFGAEADGAVWSEGAGLIMIKRLADAVRDGDRVLAVVRGSAMNQD
GRSQGLSAPNGSAQERVVRSALAAAGVTPAEVDYVEAHGTGTPLGDPVEARALARVYGAG
RVGRPLGIGSLKSNIGHTQAAAGISGVIKTVLALGNQTLPATLHAETPTAQLDWSANGLA
VQNRAAPWNGDERPRRAGVSAFGISGTNVHVILEEAPAVAPLGENPGDGLESTLVPVSAR
SAGSLRGQAERLLRLLESDPGLRPEAVARSIALRRTHFDNRAAVIASDRDELLNGLRALA
QGDEAADVVTGSRPALSSGKLAFVFPGQGAQWAGMARDLLERSEVFRAEFERCDAVLRAQ
TGWSVAAVLRGDEDVALERVEYIQPLLFAVMVSLAAVWRTAGVEPDAVVGHSQGEVAAAC
VAGALSLRDAAAVVAHRSRIVAETAEPGAMAMIGLPAARVAELLTDDRMSIAAINSARAT
VVTGAVHAVESLVETLTAEQIFVRRIDVDYASHSEYMAPVRDPLLAVLAGLQTGPTTVGW
YSTVLGEPVGERALPTEYWYDNLREPVRFADAVERMLDDGYRYFVEMSAHPSMLTAITTI
AEDRSREVAAIGSLRRDADGPRSLDRSLAELYTAGRDLDWDRLLPNQPPVDLPTYAWDLR
SYWMEPARLDPERFGLSAVAHPILGASVAQADSGGVVFTGTVSARTHPWVLDHRVAGTVL
LPGAAIVDMTVCAGHEVGATTVRELVLHAPAVIAPDAVLRIQVSVGEPDERGERTVAVHS
RADDNAGWVLNGNGVLSDDIASGTTSLAPWPPQDATAVEVSDRYSELAERGYEYGPAFRG
LRALWRRGQDIFAEVALPTAIEDEGYGLHPAVLDAALHAAVAADFGTAPDAVLLPFSWSG
VTLHASGASTLRVHLIPAEGMTLRVHLADSTGRPVADIESLRLRPITPDALTAGIGDALY
GVDWVPLRTPDEAVGDIAWSDIATAAPEPDTQPVLIVRNLHRAGDSTPNDAAPARMEFPA
TSTDFAATGTDLAKTGTESTAPGTELAASENNSTSPDTVVTKAATESTAAIGSAAVTGEI
ATADTFPVQRPSTAGIDPTATAADFAAGAELAHVGSDFAAMVRESTASVLSRVQEWLAGG
ADDRALIVVTSGAVVVDGVDEVAGLVDAPVWGLLRSAQTEYPGRITLVDVDDPGGVDRAV
ALAAGGSESQLAVRRSVAYTPRVGRVDGGVVGNAGLLRRESWRLETLGRDTVHGDNVVLG
DDFGSTPLASGQVRIAVRAAGLNFRDVLIALGMYPDADAPVGGEGAGVIVEVASDVTDLA
PGDRVSGLFAGIAATVVADRRTVVPIPADWSFAQAASVPIVFATAYHALVDLAGLRSGES
VLIHAATGGVGMAAVQLARHLGAEIYVTAAPAKWNVLHAMGFDAAHIASSRSPEFERDFR
AATGGRGVSVVLNSLTGEYIDASLRLLAPGGRFVEMGLTDLRDRAELGERFPGVEYHPFV
LMDAGPDHLRHILSALLDLFAEGALTPLPVTAWDVRRTPEAMRVLSQARHIGKNVLTVPP
AFDPEGTVLVTGGTGMVGSHIARHLVTDWGARYLVLTSRRGEDAPGAAELAAELTALGAV
VRIIACDTADREQVRELLANVPGRHPLTAVIHAAGVLDDALFSAQTSERLDTVLRPKVDA
AWHLHELTADRDLSAFVLISSVAGILGGPGQSNYAAANTFLDALAQHRQHRGLAGSSLAY
GFWAETSGLSRHLDNSDRARMSRGGVAALSTREGLELFEAATTSGRPLVLPMRLDSSRGD
QVAPMLRGLLRTPRRLIRADAPGAADGLAADLAGRDVTEQRRILLALIRTHAAAALGHDG
PEAVEPDRTFKDLGFDSLGAVEFRNRLEQASGVRLPVTAVFDYPTPSALADFVRTTIGAD
TVEPATPAPVRATADDPIVIVGVGLRYPGGATTPAQLWDIVEQRRDVMTEFPADRGWDLA
ALYDPDPATPGTTYARAGGFLDGIGDFDAAFFGIPPREALAMDPQQRLLLEASWEAIERA
GIDPKSLHGTATGVYAGVTYADYAARLAGRIPDEVEPYLGESSTFSVASGRISYTLGLHG
PAVTVDTACSSSLVAMHLATRALRSGECTLALAGGVTVMSSPQVLTGFARQRGLSADGRC
KAFADAADGTGFAEGVGVVVLERLSDAVANGHSVLAVVAGSAVNQDGASNGLTAPNGPAQ
QRVIRAALADAGVTAAEVDVVEAHGTGTTLGDPIEAQALLATYGREHTDDRPLWLGSIKS
NIGHAQAAAGIAGVVKLVEAMQRGVLPATLHVDRPSRHVDWSQGSVELLTEARAWKRSEH
PRRAGISGFGISGTNAHLILQEPPESEERVAPTQPIPLVPLVLSAASEAALQGQARRLRA
RIEADPELDLTDIGWSLVTSRSRFDERAVILASDRERVLSGLAAVADGADGPGVVRGRAG
TAEETVFLFPGHGAQWAGMAVELFDTTPVFAERLTECAAAIEEFVDWSVLGVLRETADAP
PLNRVDVVQPVMFAVTMALTALWESVGVTPAAVIGHSFGEITAACTAGALSLRDAALVIT
ARGRALLPLAGAGGMLSVPLPEQTVREHLSYYGERLVIAGVNSPASTVVSGDLAAVEELH
ARYTADGVRARRVPIEFASHSPHVEAAHEELRTAWADVTARAGHTTVLSTVTGDVYDTGN
MDGAYWYRNVREPVRFADAVRRAYELGYRKFVEVGPHPALLPVTVETLEDAGQDVFVGAT
LRREAGGPARFLESAARLHVAGGPVRWADVFTGSGARRVDLPTYAFDRERYWLDAGPADR
DATGLGQRDAAHPLLGAVVAAADSGGVILTGRISLHAQPWLTGHTVAGTVLLPGTAFLEM
AIRAGDETGAPIVRELLLEEPLVVPDRSGVDVQVTVGAADAGGDHPVSIYSRPSEDSAAQ
WVRHAQGVLGTTAPVLGADPGVWPPPSAEALPVDGVYDRLAERGYDYGPEFRGLHAVWRS
GDELFAEVVLPESAHRDAGGFGIHPALLDAALHVLAFEHGDDRLLLPMAWTGVTLAASGA
RTLRVRLTRSGAGSVGLVAVDPGGQPVLAVESILTREVSPQQLSAFGFHADLLRTQWIEI
PALTDDAPGVPQSWHHLTDSVPETIVYEGVPGNTPEAVRAAVRELLSVVRPFVTESRFDR
SRLVICTRAAMGRDGEDVSDLAGAAVWGLARTVQSEHPGRVVLLDTDDSAGIGAALASGE
PQLLVRGGAMYGARLQRIPRAEAAQSRPLSDGTVLVTGASGALGGMIARHLVTHHDARRL
LLVSRRGPDAPGASALRDELTALGAEVTVAACDVADRDGLRALLDGVRLSGVVHTAGVVD
DATVAALTPAQLDTVLRPKVDGALHLHELTAGQDLSLFVLFSSIAGMIGAPGQGNYAAAN
VVLDALAAHRRAHGLPAHSLAWGMWDTGLAAAVGDADRARLRRSGLVPLTPETGTALFDT
AIGLDLPGIAPLRLDLAAIRKLPQVPPLFHALVRPTAQRAVAGDADPDTVARLAARLAAL
PEDAAVAVMLDLVRSRAATVLGHGSATDIAAERAFSSYGFDSLMAVEFRNTLRAATGRPL
PITVVFDYPNPLELARYLVSEIRPSAETETDSDDERIRAVLQRIPIDTLRDTGLLDAILA
LSGEEPVESGSATTDQLDDVDAELAELDAEALIELALGDE
NT seq 13803 nt NT seq  +upstreamnt  +downstreamnt
ttgccggggccgatttcgagccaggacgccacggggggcgtgatgtaccgttctatcgtc
gatgtgctcgcgacctggagttcgctacggccggaccgggtcgcctaccgctatctggaa
acaggtgacgtcgacggcgccacgagcactctcacctacgcgcagctcgagcgccgcgcg
cattcggtcgccgaacggttgcgcgagggcgggttcaccggtgagcgggccctgctgctg
tatccgccgggactcgagttcgtaccgggtttcttcggctgcgccgtcggatccgtggtc
gccgttccggcgccgctcccgcaactgcacgagctgagccggtcgctgcggcggttgcgg
cagatcgtggccgatgccgagatccggtgcgtgctcaccacccgagcggtcgtggatctg
ctcggtgcggtggtcgcggaacttcccgaactcgccgcgatgacctggatcgccaccgac
gagatcgacatctcgaccgcggccgcattcgacactccccggatcgacccggattcggtc
gccttcctgcagtacacctcgggctccacctccgcaccgcgcggtgtgatcgtcagccac
cgcaatctcctgcacaacgagcaggcgatcgccgaaaccttcgggcacacagccgatctg
gtcgacaactggcagggcgacctgttcctgagctggctgccggtcttccacgacatggga
ctcatcggccccatcctgcacacggtgtatctcggcacgaccgtcacgctgctctcgccg
ctgcatttcctggagaagcccgagcgctgggtcaccgcgatgtccgcattcggcgcacac
agcagtggcgcaccgaatttcggctacgagatcgccgcgcgacgcgcgacgccggaactg
gtggaacgactcgatctgagccgctggcgggtggcgttcaacggcgccgaacccattcgc
gccgagacgttgcgccgcttcgccgacaccttcggtcccgccggattccggtccgagtcc
ttcctgccggtgtacgggctcgccgagggaactctgctggtcagcggcagcggcggtatc
gatcgcgcaccctctgtcatcgagcgggcgaagccgggcgaggcgggcacgccctgggtg
ggctcgggtcgcgcgcccgaaggcatcagcatcgtgatcgtcgatccggagacccggatc
cgctgtgccgacggcgaagtcggtgagatctggacggcgagcgacagtgtcgccgacggc
tatctcggacatcccgaactcaccgaggcggtattccgggccaccctcaccgacggcagt
ggaccctatctgcgcaccggagatctcggattcctcagcgacggtgagcttttcgtcacc
gggcgcgccaaggatgtgctgatcatcgacggcaggaaccactatccgcaggatctggag
gcgtcggtcgaggccgcgcacgccacggtccgcgcgggctgcgtcgccgccttctccgtc
gagggcgcggacggcgagcgaccggtggtggtggccgaggtcaagacgaccgacgccgac
gagctggcggccgccgagatggcggtgcgcgccgtcctgggcaccgaacacggcctcgca
ccgcacgcgatcgaattcgtcgcaccgcgcacgatcctcaagaccagcagcggaaagatc
cagcgccaggcgtgtcgcgccgcttatctcgcgggtgagctgtctctcgtggcgccgaag
caggcggctaagtccggaccggacactcagtctgtctcggccacaacgacggtcacggcc
gctgccaccggctatgaccgagaatccgtcaccgcgtggctgatcgacgcggtcgcggcg
cacacacatcttgacgcctcgcgaatcgatgtgcatcgtccgctgtcggaattcggcctg
ggctcacgcggtctcgtggagctggtcaccgaactgtcggaacatctgggccgcaccgtc
gatcccgcaatggtgttcgaacatcccacgatcgcgcagctcgcggcggcactgcgcccg
ggtgaggtggtatcggaggcgacgggcgaacgtgacctgtccggcgagccgatcgcgatc
gtggccatggcgtgccgtctgcccggcggggtggacgatccggaagcgttgtggcagttg
ctgtccgggggtcgcgacgcgatcaccgaggccgagcgctggcggaccgaggctctctac
gatcccgacccggaggccgtgggcaaggcctacacgctgcgcggcgggttcctcgacgac
atcgacctcttcgatgccgcgttcttcggaatcggcccgcgcgaagcggccgcgatggat
ccgcagcagcggctgttactccagctgagctgggaggtcgtcgaacgatcgggccgggat
ccgcgcacactcgagggcacctccaccggcgtcttcctgggcctctacggcagcggttac
ctcgccggagccgggccggaccagatgaacggacatctcggcaccgggtccgcgctcagc
gtggcatccggccggatcgcctacagcctgggactgcacggccccgccctcaccgtcgac
accgcctgttcgtcgtcgctggcggccctgcatctggcgattcgctcactgcgcgccggg
gaatgtgacaatgcgctggtcggtggtgccacactgctggtttcgccgaacgggcacgtc
gagttcagcaagctgggcgtgctgtccccgtccggtcgcacggcggcgttcggcgcggag
gcggacggtgcggtgtggtccgagggcgcgggcctgatcatgatcaaacgcctcgccgac
gccgttcgtgacggcgatcgggtgctggcggtcgtgcgcggctcggcgatgaaccaggac
ggccgcagccagggcctgagcgccccgaacggctcggctcaggagcgggtggtgcgatcc
gcgctggcggcggcgggtgtgacgcccgccgaggtggactacgtcgaggcgcacggaacg
ggcacaccgctcggtgatcccgtggaggcccgcgcactggcccgtgtctacggtgcggga
cgcgtggggcggccgctgggcatcgggtcgctgaagtcaaatatcgggcacacgcaagcg
gctgccggtatcagcggtgtgatcaaaaccgttctggcactgggcaaccagacgctgccc
gccacactgcacgcggaaacccccacggcgcaactggattggtcggcaaatggactggcc
gtacagaaccgtgcggctccgtggaacggcgatgaacgaccccggcgggccggggtgagc
gcattcgggatcagcggaaccaatgtgcacgtgatcctggaagaggctccggccgtcgcg
ccactcggcgagaacccgggcgacgggctcgaaagcacactggtgccggtgtcggctcgg
agcgcggggtcgctgcgtgggcaggccgagcggctgctgcggctgctcgaatccgatccc
ggactccggccggaggcggtggcgcgctcgatcgccttgcgccgcacacacttcgacaat
cgcgctgcggtcatagcctcggaccgcgacgaactcctgaatgggctacgagccctggca
cagggcgacgaggctgccgatgtggtgacggggtcgcgccccgcgctcagctcgggcaag
ctggccttcgtcttcccgggccagggagcgcagtgggccgggatggcgcgggatctgctc
gagcgatccgaggtcttccgcgccgaattcgaacggtgcgatgcggtactgcgcgcccag
acgggctggtcggtcgccgccgtcctgcgcggtgacgaggacgtcgcgctggagcgggtg
gaatacattcagccgctgctgttcgcggtgatggtgtcgctggccgcggtctggcggacg
gcgggtgtcgaaccggatgcggtcgtgggacacagccagggtgaggtcgccgccgcctgt
gtggcgggtgccttgagtctgcgcgatgcggcggccgtggtcgcgcatcgcagccgcatc
gtggccgagaccgccgaacccggcgccatggccatgatcggattgcccgcggcgcgggtg
gccgaactgctcaccgacgaccggatgtcgatcgccgcgatcaacagtgcgcgcgccacc
gtggtgaccggagccgtccatgcggtggagtcgctggtcgaaaccctcacggccgaacag
attttcgttcgcaggatcgacgtggactacgccagccactccgagtacatggcgccggtg
cgggatccgctgctggccgtcctggcgggactgcagaccgggccgaccaccgtgggctgg
tattcgaccgtcctgggtgaaccggtcggggaacgggcgctgcccaccgagtactggtac
gacaatctgcgggaaccggtccggttcgcggacgccgtggagcgcatgctcgatgacggg
taccggtatttcgtcgagatgagcgcccatccgtcgatgctcaccgcgatcaccaccatc
gccgaggaccgcagccgagaagtggcggctatcggctcgctgcgccgcgacgcggacggc
ccgcgcagcctggaccggtcgctggccgaactgtacacagccggcagagatctggattgg
gaccggctgctgccgaaccagcctccggtggatctgccgacctatgcgtgggatctgcgg
tcgtactggatggagcccgcgcggctcgatccggagcgcttcggactgtcggccgtggcc
catccgattctgggcgcctcggtggcacaggcggattcgggcggtgtcgtgttcaccgga
acggtgtcggcgcgcacccacccctgggtgctcgatcaccgggtcgcggggacggtgctg
ctgccgggtgcggcgatcgtggacatgaccgtgtgcgccgggcacgaggtcggcgcgacc
accgtgcgggaactggttctgcacgcaccggccgtcatcgcgccggatgccgtcctgcgg
atccaggtgagcgtgggcgagcccgacgagcggggcgaacggaccgtcgcggtgcactcc
cgcgcggatgacaatgcgggctgggtgctcaacggaaatggcgtgctgagcgatgacatc
gcctccggcacaacgtcactcgcgccctggccgccgcaggatgccaccgccgtagaggtg
tccgatcggtattccgagctggccgaacgcggttacgagtacggcccggcattccgcgga
ctgcgcgccctgtggcgacgcgggcaggacatcttcgccgaggtcgccctgcccaccgcg
atcgaggacgaaggttacggcctgcatccggcggtcctggacgccgccctccacgctgcg
gtggccgcggacttcggcaccgcgccggatgccgtactgctccccttctcatggtccggc
gtgaccctgcacgccagtggcgccagcacgctccgcgtccatctgatccccgctgagggc
atgacactgcgtgtgcacctcgccgattcgacgggacggcccgtggccgacatcgaatcg
ctgcggttgcgcccgatcaccccggacgcactcaccgccggtatcggcgacgcgctgtac
ggagtggattgggttccgctgcggactccggacgaggccgtcggagatatcgcatggtcc
gatatcgccacagccgccccggaacccgatacccaaccggttctgatcgtccgcaatctg
caccgcgctggcgactccacaccgaacgacgctgccccggctcggatggaattccccgcc
accagcacggactttgccgccacaggcacggatctcgcgaagacaggcaccgagtccact
gcgccaggcaccgaactcgccgcgtcagaaaacaattccacgtcacccgacactgtggtc
accaaggcagccaccgagtccacggcggccatcggatccgcggcggtaaccggggagatc
gcgacagctgacactttcccagtccagcggccctccacggcaggcatcgaccccacagcg
acggcagcggatttcgcggctggtgccgaattggcgcacgtgggatcggatttcgcggcg
atggtgcgggagtcgactgcgtccgtgttgtcacgggtgcaggagtggctcgcgggtggg
gctgatgatcgggcgctgatcgtggtcacctcgggggccgtggtggtcgatggggtcgat
gaggtcgccgggttggtggatgcgccggtgtgggggttgttgcggtcggcgcagaccgag
tatcccgggcggatcacgctagtcgatgtggatgatccgggcggtgtcgaccgggcggtg
gcgctcgctgcgggcggttccgaatcccaactggccgtgcggcgttcggtcgcatacacg
cccagggtcggccgggtggacggtggagttgtcggcaatgcgggtctgctgcggcgggaa
tcgtggcggctggaaacgctcgggcgcgacaccgtgcacggtgacaatgtcgtcctgggt
gacgatttcggcagcacgccgcttgcgtccgggcaggtgcggatcgccgtgcgggcggcc
gggctcaacttccgcgatgtcctgatcgcgctcggcatgtatcccgatgccgatgctccc
gtcggcggcgagggcgcgggtgtgatcgtcgaggtcgcctcggacgtcaccgatctcgca
cccggcgaccgggtatccggcctgttcgcggggatcgccgcgaccgtcgtggccgatcgg
cggacggtggtgccgattccggcggactggtcgttcgcgcaggcggcctcggttccgatc
gtgttcgccacggcctatcacgcactcgtcgatctcgccgggctgcgctccggggagtcg
gtgctgattcatgccgcgaccggcggggtggggatggccgcggtgcagttggcccggcac
ctgggcgccgagatttatgtcaccgctgccccggccaagtggaatgtgctgcacgccatg
ggattcgacgcggctcacatcgcgtcctcgcgcagcccggaattcgagcgggacttccgt
gcggcgaccggcggccgtggcgtctccgtcgtgctgaactcgctcacgggcgaatacatc
gacgcctcactgcgattgctcgctcccggtggacgtttcgtggagatgggtttgaccgac
ctccgcgaccgagccgaactcggcgaacggttccccggcgtcgagtaccacccgttcgtg
ctgatggacgcgggcccggaccacctgcggcacatcctgtcggccctgctcgacctcttc
gccgagggcgcgctgacgccgctgccggtcacggcgtgggatgtacgccgcacaccggaa
gcgatgcgcgtgctgagccaggcccgtcacatcggtaagaacgtgctcacggtgccaccc
gccttcgaccccgagggcacggtacttgtcaccggcggcaccggcatggtcggatcccac
atcgctcgccatctcgtcaccgactggggcgcaaggtatctcgtgctcaccagtcgccgc
ggcgaggatgcgcccggcgccgccgagctggcagcggaactgaccgctctcggcgcggtc
gtgcgaatcatcgcctgtgacacagccgaccgcgaacaggttcgcgagctcctcgcgaat
gtgcccggacggcatccgctgaccgccgtgatccacgccgcgggagtgctcgacgacgcg
ctgttctccgcccagacatccgagcggctcgacaccgtgctgcgtcccaaggtcgacgcg
gcctggcatctgcacgaactgaccgcggaccgggatctgtcggccttcgtcctgatctcc
tcggtggccggaatcctgggcggaccgggacaatcgaactacgccgcggccaataccttc
ctcgacgcgctcgcccagcatcggcagcaccgcggactcgccggtagctccctggcctat
gggttctgggccgagacgagcggcctgagccgccatctggacaacagcgaccgcgcccgg
atgagccgcggcggggtggcggcactatccacccgtgaagggctcgaactgttcgaggcc
gcaaccacttccggccgccccctggtgctgccgatgcggttggactcgtcccgtggggat
caggtggcgccgatgctgcgcggcctgctgcgcacccctcggcggttgatccgcgccgat
gcgccgggcgcggccgatggtctggccgccgatctggccggtcgcgatgtgaccgagcag
cgccgcatcctgctggcactgatccgcacccatgccgcggcggcgctgggccacgatggg
ccggaggcggtcgagccggatcgcaccttcaaggatctgggtttcgattcgctcggtgcg
gtcgagttccgcaatcggctcgaacaggccagtggtgtacggcttccggtgacggcggtc
ttcgattacccgacgccgtccgcactcgcggacttcgtccgcaccacgatcggcgcggac
accgtcgaacccgccacaccggcgccggttcgcgccaccgccgacgatccgatcgtgatc
gtcggtgtgggactgcgctatccgggtggcgcgacgacgcccgcgcaactgtgggacatc
gtcgagcagcgccgcgatgtgatgaccgagttcccggccgatcgcggctgggacctcgcg
gcgctctacgatccggaccccgccacccccggcaccacctatgcgcgtgcgggcggattc
ctcgacggtatcggcgatttcgacgccgcgttcttcggcatcccgccgcgggaggccctg
gcgatggatccgcaacagcggttgctgctggaggcgtcctgggaggcgatcgaacgggcg
gggatcgatccgaagtcgttgcacggcaccgcgacaggcgtgtacgccggtgtcacctac
gccgactacgcggcccggctggctgggcggatcccggacgaggtcgagccctatctcggc
gagagcagcacgttcagcgtcgcctccggccggatctcgtacacgctgggactgcacggc
ccggcggtcaccgtcgataccgcgtgttcgtcgtcgctggtcgcgatgcatctggcgact
cgggcgctgcgttcgggtgaatgcacgctggcgctggcgggcggtgtgaccgtgatgagt
tcaccgcaggtgctcaccggattcgcccggcagcgcgggctgtcggcggacggccggtgc
aaggcattcgccgacgccgccgacggcaccggcttcgccgagggtgtgggtgtggttgtc
ctggaacggctctcggatgcggtggccaacggccattcggtactcgcggtggttgccggg
tccgcagtgaaccaggacggtgcgagcaacggcctgaccgcaccgaacgggcccgcccag
cagcgagtgatccgcgcggcactggccgatgccggagtcaccgccgccgaggtggatgtg
gtcgaggcgcacggcaccggaacaactctcggcgacccgatcgaggcacaggcgctgctc
gccacctacggccgcgagcacaccgacgaccgcccgctgtggctgggctcgatcaagtcg
aatatcggtcatgcgcaggccgccgcgggtatcgccggtgtggtgaagctggtcgaggcg
atgcaacgcggtgtactgcccgcgaccctgcatgtggaccggccgagcaggcatgtggat
tggtcgcagggatcggtggagctgctgaccgaggcgcgggcgtggaagcgctcggaacat
ccacggcgcgcaggtatttcgggattcggcatcagtggcacgaacgcccatctgatcctg
caggaaccaccggagtccgaggagcgcgtcgcgccgacacagccgattcctctggtgccg
ctcgtgctctcggcggcctccgaggcggcgttgcagggccaggcccggcggctgcgggcg
cggatcgaggcggatccggaactggatctcaccgatatcggctggtcgctggtgacgagc
cggtcgcggttcgacgagcgcgcggtgatcttggcgtccgatcgagagcgggtgctgtcg
ggtctggcggccgtggcggacggtgccgacggccccggggtcgtgcgtggaagggccggg
acggccgaggaaacggtcttcctgttccccgggcacggcgcgcaatgggccggcatggcg
gtcgaattgttcgacaccacaccggtattcgccgagcggctgaccgaatgcgcggccgcg
atcgaggagttcgtcgactggtcggtcctcggcgtactgcgcgaaaccgccgatgcgccg
ccgctgaaccgcgtggacgtggtgcagccggtcatgttcgcggtgacgatggctttgacg
gcgctgtgggagtcggtgggcgtgacccctgcggcggtgatcgggcattcgttcggcgag
atcaccgcggcctgcaccgccggtgcgctgtcgctgcgtgatgcggcgctggtgatcacg
gcccgcggacgggcgctgcttccgctggcgggcgcgggcggcatgctgtctgttccgcta
ccggaacagacggtgcgggaacatctttcgtactacggcgaacggctcgtgatcgcgggc
gtgaacagcccggcatcgaccgtcgtctccggtgacctcgcggcggtcgaggaattgcac
gcgcgctatacggcggacggtgtccgggcgcggcgcgtgccgatcgaattcgcctcccac
tccccacatgtcgaggccgcgcacgaagaactccggacggcctgggccgatgtcaccgcc
cgcgccggacacaccaccgtcctgtccacggtgaccggcgacgtgtacgacaccgggaac
atggacggcgcgtactggtatcgcaatgtccgcgagccggtgcggttcgcggatgccgtg
cgccgggcatacgagctcggatatcggaagttcgtcgaggtgggaccgcatccggcactg
ctgccggtgacggtggagaccctggaggacgcgggccaagacgtcttcgtcggcgccacc
ctgcgccgcgaggcgggcggcccggcccggttcctggaatccgcggcccggctccatgtg
gcgggcgggccggtgcgctgggcggatgtgttcaccggcagcggtgcgcggcgggtcgac
ctgccgacctacgccttcgaccgcgagcgctattggctggacgccggacccgccgatcgg
gacgccaccggcctgggccagcgcgatgccgcacatccgctgctgggcgcggtggtggca
gcggccgactccggcggtgtgatcctcaccggccggatatcgctgcacgcacaaccgtgg
ctgaccggacatacggtcgccggtaccgtactgctcccggggaccgcattcctggagatg
gcgatccgcgcgggcgacgagaccggcgcgccgatcgtccgggagctgctgctggaggag
ccgctggtcgtaccggaccggtcgggcgtcgatgtccaggtcacggtcggtgcggccgat
gccggcggcgaccatccggtgagcatctactcgcgcccctcggaggactctgcggcccaa
tgggttcggcacgcgcagggcgtactcgggaccaccgcgccggtgctcggggcggacccg
ggggtctggcctccgcccagcgccgaggcattgccggtggacggtgtctacgatcggctg
gccgaacgcggttacgactacggcccggaattccgcggtttgcatgcggtgtggcgcagc
ggtgacgaactgttcgccgaggtcgtcctgccggaatccgcccatcgcgatgccgggggt
ttcggaatccatccggccctgctcgatgccgcactgcacgtactggccttcgaacacggt
gacgatcggctgctgcttccgatggcatggaccggcgtcaccctggcggcctccggtgcg
cggacgctgcgggtacgcctcacccgcagcggcgcggggagtgtggggctggtggccgtc
gatccgggcgggcagcccgtactcgcggtggaatccatactgacccgcgaggtctcacca
cagcagttgtcggccttcggtttccatgccgatctactgcgcacccagtggatcgagatt
ccggcgctcaccgacgatgctcccggcgttccgcagtcctggcaccacctcaccgacagc
gtcccggaaaccatcgtctacgaaggagttccgggaaacacacccgaagccgtccgcgcg
gcggtgcgcgaactgctgtccgtcgtgcggcccttcgtcaccgaatcacggttcgaccgt
tcgcgattggtgatctgcacccgcgcggcgatgggccgcgacggcgaggacgtctcggat
ctggccggtgcggccgtctggggtctggcccgcacggtgcaatctgagcatccgggccgc
gtcgtactgctggacaccgatgacagtgcgggcatcggcgccgcactcgcgagcggggag
ccacagctcctcgtacgcggcggcgcgatgtacggggcacggctgcaacggattccgcgc
gcggaggcggcgcaatcacggccgctgtcggacggcacggtgctggtcaccggcgcgtcc
ggggcattgggcggcatgatcgcacggcatctggtgactcatcacgacgcacggcggctc
ctgctggtgagccgccgcggacccgatgcaccgggcgcctccgccctgcgcgacgaactc
accgccctcggcgccgaagtgaccgtcgccgcctgcgatgtcgccgatcgcgacggactg
cgcgccctgctcgacggtgtgcgattgtccggcgtggtgcacacggccggtgtggtcgac
gatgccaccgtcgccgcgctgaccccggcgcagctggacaccgtcctgcgcccgaaagtc
gatggggcactgcatctgcacgagctgacggccgggcaggatctgtcgctgttcgtgctg
ttctcctcgatcgcgggcatgatcggcgcacctgggcagggcaattacgcggccgccaat
gtcgtactcgacgcgctcgcggcgcatcgccgcgcgcacggcctgcccgcgcactcgctg
gcctggggtatgtgggacaccggtctggccgcggcggtcggcgatgccgatcgagcccga
ttgcgtcgttccggactggtgccgttgacgccggagacgggaacggccttgttcgacacc
gcgatcggactcgacctgcccggcatcgcacccctgcgcctggacctcgcggcgatccgc
aaactaccgcaggtgccgccactgttccacgctctggtgcggcccacagcgcagcgcgcc
gtcgcgggtgacgcggatccggatacggtcgcccggctggccgcgcgcctggcggcgctg
ccggaggacgcggcggtcgcggtcatgctggatctggtgcgctcgcgggccgccacggtg
ctcggccacggatccgccaccgacatcgccgccgaaagagccttcagcagttacggtttc
gattcgctcatggccgtcgagttccgcaacacgctgcgcgccgccaccggtcggccgctg
ccgatcacggtcgtgttcgactatccgaatccgctggagctggcccgctatctggtgagc
gagatccggccgtccgccgagaccgagaccgactccgacgatgagcggattcgcgctgtg
ctgcaacggattccgatcgacacactgcgcgacaccgggttgctcgacgccatcctcgcc
ctctccggtgaggagcccgtcgagagcggctccgcgaccaccgatcaactcgacgatgtg
gacgcggagcttgccgaactcgatgccgaagcgctcatcgagctcgcgctcggggacgaa
tag

DBGET integrated database retrieval system