KEGG   Nelumbo nucifera (sacred lotus): 104593573Help
Entry
104593573         CDS       T04131                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1-like
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nnu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    104593573
Enzymes [BR:nnu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104593573
Chromosome [BR:nnu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104593573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 739 aa AA seqDB search
MERGPSPDSVPHSGAEDKSRVLNVRPLRCLAPVFPTPHGFTTFTVPQAPPFVYAPPFGPF
PPGFTAFYPFFIPTDPQRPPEQHTQTPSGATTQAGVFGFGHPAQTPTTPVPLFRPPAPPQ
PPQFVGTSNGNVGSSKKSSRHQEAGAQSQPQAANKSESVRSAMEEDGCSDNQKRPAHNIS
SCNVQFTDVEATSSAEKQKTKSNKRVRESQGVRLSSTGDGDRESLGHILMTFDAIRRRIA
QIEDAREPTSGTIKRADLRAGTIMLNNGLRANTRKRIGAVPGVEIGDVYFFRMEMCLVGL
HAPCMAGIDYMSLRYDQEEEPVAVSIVSSGAYEDDVDDPDMLVYSGQGGNFNKKSKQAVD
QKLERGNLALEKSLRRANEVRVIRGMKDIGSPTGKVYVYDGLYKIQESWMEKGKSGYNVF
KYKLVRLQGQPAAFSIWKSIQQWKENITTRAGVILPDLTSGMENLPVSLVNDVDEEKGPA
YFTYFPTLKHSKPVSSAEPSLGCNCHGGCQPGDSNCSCIQKNAGDLPYTGNGVLVMQKPL
IYECGPSCPCYTQCRNRVSQTGLKVHLEVFKTKDKGWGLRSWDPIRAGTFICEYAGEVID
YIKVEEDSEEEEQDEYIFDSSRTYDNSLKWNYVPELLGEEVLGDSKETSKPPQSVMITAK
NFGNVARFMNHSCSPNVFWQPVLQEHKKESHIHIAFYAIRHIPPMTELTYDYGISGTQSS
YHRKKKCFCGSLNCRSYFG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaggtcctagtccagattcagttccacattcaggtgctgaggataagtctaga
gtcctgaatgtaaggcctttgcgttgtttggctcccgttttcccaactccgcatggattc
accacattcactgttccccaagctcctccttttgtctatgcacccccatttggtcccttt
cctcccgggttcactgcattttacccctttttcatccctacagatcctcaaagaccacca
gaacagcacacacagaccccgagtggagcaaccactcaagctggtgtttttggattcggt
catccggcacaaactccaaccactccagtgcctttgtttaggccacctgctcctccccaa
ccgcctcagtttgtaggaacttcaaatggtaatgtagggtcatcaaaaaagagctccagg
caccaggaagctggtgcacagtcacaaccacaagcagcaaacaagagtgagtctgttagg
tcagcaatggaagaagatgggtgcagtgataaccagaagcgccccgcccataatattagt
agctgcaatgttcaattcacagatgtggaagctaccagcagtgctgagaagcagaagacc
aagtcaaacaaaagagtgagggaaagccaaggggtgaggttatcctcaacaggtgatggt
gatagggagtcacttggacatattctcatgacatttgatgccatcaggcgaaggattgct
caaattgaagatgcaagggagccaacctctgggacaattaaacgtgcagatctgagagct
gggacaatcatgttaaacaatgggctccgggcaaatacaaggaagagaattggagctgtt
cctggagttgagattggagatgtttactttttcaggatggagatgtgcttggtgggattg
catgctccatgtatggctggaatagactacatgagtctcaggtatgaccaagaagaagaa
cctgtggctgtaagcattgtttcatcaggagcatatgaggatgatgtggatgatccagat
atgttggtttacagtggccaaggtggaaactttaacaagaaaagtaaacaagcagttgat
cagaagcttgaaaggggtaaccttgctttggagaaaagtttgcgtcgggctaatgaggta
agagttattcgaggtatgaaggatatagggagcccaacagggaaggtctatgtctatgat
ggtctctataagatccaggaatcttggatggagaaagggaagtcaggctacaacgttttc
aaatataaattggtaaggctacaggggcagcctgctgcattttcaatatggaaatctatt
caacaatggaaggagaatatcacaactagggctggtgttatcttgcctgacctgacctca
gggatggaaaatttacctgtttcccttgtaaatgatgttgatgaggagaaaggccctgct
tatttcacttatttccctaccctgaaacattcaaaaccagtcagctcagctgaaccttct
cttggctgtaattgccatggtgggtgccaaccaggtgattccaattgctcttgcattcaa
aagaatgcaggcgatcttccctatactggaaatggtgttcttgtgatgcagaaacccttg
atatatgagtgtggcccctcttgcccatgctatactcaatgcagaaatcgagtgtcccag
actggtttaaaagttcacctggaggtgtttaagacaaaggataaaggttggggtctcagg
tcttgggatcccatccgtgcaggtacatttatttgtgaatatgcaggagaagtcattgat
tatataaaagtagaggaggacagtgaggaagaagaacaagatgagtatatatttgattcc
tctcgcacttatgacaactcgttgaaatggaattatgtacctgagttactaggagaagaa
gttcttggagactcaaaagaaaccagcaagcctccacagtctgttatgataactgcaaag
aattttgggaatgtggctcgttttatgaaccacagttgttcccctaatgtcttttggcag
ccagtcttgcaagagcacaaaaaagaatcacatattcacattgcattctatgcaatcaga
catattcctcccatgacagagttgacatatgactatgggataagcggaacccaaagttcg
taccacaggaagaaaaaatgtttctgtggatctttaaactgcagatcatattttggttag

DBGET integrated database retrieval system