KEGG   Nelumbo nucifera (sacred lotus): 104596764Help
Entry
104596764         CDS       T04131                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nnu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104596764
   00020 Citrate cycle (TCA cycle)
    104596764
   00620 Pyruvate metabolism
    104596764
Enzymes [BR:nnu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     104596764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 489 aa AA seqDB search
MAGLLNIGTSFIPSSSTSKLLRYPSSLPPANRNNPSNRTLIQAKIREIFMPALSSTMTEG
KIVSWVKSEGDKLAKGESVVVVESDKADMDVETFYDGYLAAIMVEEGGVAAVGSAIALLA
ETEEEIAEARSKANSSSSSSSSSSSSSASSSTVASKPPQEKTPEAVASSPAPSLSKQASA
PSVVAASSVHPASEGGKRIVASPYAKKLAKELKVDLGSLVGSGPMGRIVAKDVEAAAAAA
VLTESPKPAASPAPSPAKVSTTPGIELGTVVPFTTMQGAVSRNMVQSLTVPTFRVGYTIT
TDALDQLYKKIKSKGVTMTALLAKATALALVKHPVVNSSCRDGKSFTYNSSINIAVAVAM
DGGLITPVLQDADKLDIYSLSRKWKELVDKARAKQLQPHEYNTGTFTLSNLGMFGVDRFD
AILPPGTGAIMAVGASQPTVVATKDGRIGMKSQMQVNVTADHRIIYGADLAAFLQTLANI
IEDPKDLTF
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtttactcaacattggaacctccttcatcccttcttcctccacctcgaaactc
ctccgataccctagctctttgcctccagctaatagaaacaatccctccaatagaaccctt
atccaggccaagatccgggagatcttcatgcctgcattgagttcgacgatgacggaaggg
aagattgtttcctgggtgaagtccgaaggcgataagctcgccaaaggggagagtgtcgtt
gttgtcgaatccgacaaggctgatatggacgtcgagactttctacgatggctacttggct
gcaatcatggtcgaggagggtggtgtggcggctgttggatccgctattgctctccttgca
gagactgaggaggagatagctgaggccagatcgaaggccaattcttcttcttcttcttct
tcttcttcttcttcttcttctgcttcttcgtcgactgtggcttcgaagccaccgcaggag
aaaaccccagaagctgtagcttcaagtcctgctccgtctctatccaagcaagcttctgcg
ccttctgttgttgctgcatcttcagttcatccggcctctgaagggggaaagaggattgtt
gcctctccctatgcaaagaagctcgcaaaggagttgaaggtggatttgggttctctggtt
gggagtggaccgatggggagaattgttgccaaagatgtcgaggcggctgctgctgctgct
gttttgactgagagtccaaaaccagctgcttctcctgctccctcccctgccaaggtttct
accaccccgggcattgaattgggtactgttgtcccgttcacgacaatgcagggtgctgtt
agtagaaacatggttcagagcctcacggtgccaacgtttagagttggatatacaattact
acagatgccctggaccaactatacaagaaaattaaatcaaagggagtaaccatgacagca
ttgcttgcaaaggcaactgcacttgctttggtcaaacacccagttgtgaattctagctgt
agggatggtaagagctttacatacaatagtagcataaacattgctgttgctgtagctatg
gatggcgggttgatcacaccagttcttcaggatgctgacaagcttgatatctactcattg
tcaagaaaatggaaagaattggttgacaaggcccgtgcaaagcagctgcaacctcatgag
tacaatacagggacattcactctttcaaatcttgggatgtttggcgtggaccgttttgat
gccattttgcctcctggaactggagcaatcatggctgttggagcatctcagcctactgta
gttgctaccaaggatggccggattggtatgaaaagtcagatgcaggtaaatgttacagct
gatcatcgtatcatatatggtgctgatctggcagcatttttgcaaactctggcaaacatt
attgaggatcctaaagatctcaccttctaa

DBGET integrated database retrieval system