KEGG   Nelumbo nucifera (sacred lotus): 104602957Help
Entry
104602957         CDS       T04131                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00630  Glyoxylate and dicarboxylate metabolism
nnu00710  Carbon fixation in photosynthetic organisms
nnu01100  Metabolic pathways
nnu01200  Carbon metabolism
Module
nnu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nnu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
nnu_M00532  Photorespiration
nnu_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nnu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    104602957
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104602957
Enzymes [BR:nnu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     104602957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 104602957
NCBI-ProteinID: XP_010265138
UniProt: A0A1U8AH92
LinkDB All DBs
Position
Un
AA seq 182 aa AA seqDB search
MASSVLSSAAVATVSRATPAQASMVAPFSGLKSAXAFPVTRKANNDISSLPSNGGRVQCM
QVWPPLGKKKFETLSYLPPLSPESLAKEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGY
YDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAYKPP
SF
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccgtgctctcatcggcagctgttgccaccgtgagccgtgccaccccggct
caggccagcatggtggcacctttcagcggactcaagtcagcarctgccttccctgtgacc
cgcaaggccaacaacgacatcagctccctccccagcaacggtggcagagttcagtgcatg
caggtgtggccaccactcggaaagaagaagttcgagaccctrtcttacctcccaccactc
tctcctgaatcattggcaaaggaagttgactacctcctgcgcatgggatggattccttgc
ttggagttcgagttggagcatgggttcgtgtaccgtgagaacaacagatcccctgggtac
tacgacgggcgctactggaccatgtggaagctgcccatgttcggctgcactgactcgtct
caggttttggcagagctggaagaggccaagaaagcctaccccaacgccttcatccggatc
atcggtttcgacaacaagcgccaagtgcagtgcatcagtttcattgcctacaagcctcct
agcttctaa

DBGET integrated database retrieval system