KEGG   Nelumbo nucifera (sacred lotus): 104602957Help
Entry
104602957         CDS       T04131                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nnu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    104602957
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104602957
Enzymes [BR:nnu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     104602957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 182 aa AA seqDB search
MASSVLSSAAVATVSRATPAQASMVAPFSGLKSAXAFPVTRKANNDISSLPSNGGRVQCM
QVWPPLGKKKFETLSYLPPLSPESLAKEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGY
YDGRYWTMWKLPMFGCTDSSQVLAELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAYKPP
SF
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccgtgctctcatcggcagctgttgccaccgtgagccgtgccaccccggct
caggccagcatggtggcacctttcagcggactcaagtcagcarctgccttccctgtgacc
cgcaaggccaacaacgacatcagctccctccccagcaacggtggcagagttcagtgcatg
caggtgtggccaccactcggaaagaagaagttcgagaccctrtcttacctcccaccactc
tctcctgaatcattggcaaaggaagttgactacctcctgcgcatgggatggattccttgc
ttggagttcgagttggagcatgggttcgtgtaccgtgagaacaacagatcccctgggtac
tacgacgggcgctactggaccatgtggaagctgcccatgttcggctgcactgactcgtct
caggttttggcagagctggaagaggccaagaaagcctaccccaacgccttcatccggatc
atcggtttcgacaacaagcgccaagtgcagtgcatcagtttcattgcctacaagcctcct
agcttctaa

DBGET integrated database retrieval system