KEGG   Nonomuraea sp. ATCC 55076: BKM31_00105Help
Entry
BKM31_00105       CDS       T04759                                 

Definition
(GenBank) catalase HPII
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
noa  Nonomuraea sp. ATCC 55076
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:noa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BKM31_00105
  Amino acid metabolism
   00380 Tryptophan metabolism
    BKM31_00105
Enzymes [BR:noa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BKM31_00105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(20546..22549)
Genome map
AA seq 667 aa AA seqDB search
MQSERDAKDRQLDEHRVPLDDHTMTTDQGIPVDDTDNSLKAGTRGPTLMEDFHFREKITR
FDHERIPERVVHARGSGAYGIFELYEPLGEYTCAEFLNDTSARTPTFVRFSTVAGFRGSA
DTVRDVRGFATKFYTGQGNFDIVGNNIPVFFIQDGIKFPDFVHAVKPEPHWEIPQAQSAH
DTFWDFVQLQPESLHMVMWVMSDRAIPRSYRMMQGFGVHTFRLVNAQGQGTFVKWHWRPR
LGTYSLVWDEVLRIQGNDPDFNRRDLWEAIERGAYPEYELCVQLVPESREHDFDFDLLDP
TKIIPEEQVPLRPIGKMTLTRNPQNFHAETEQVAFHTANVVPGIDFTNDPLLQARNFSYL
DTQLLRLGGPNFTQIPINRPIAPVRNDQRDGFHQHLIHESRTSYAPNSISGGCPAARDGY
RHYQEKVEGTKIRRRSPSFEDHYSQATLFWNSMADWEKRHIVAAFLFELGHVERPPIKQA
VVAHLGRIHPDLGAAVAQGLGLPAPGGGQVHSRTSPALSMTGQPRSVATRKIAILMADGT
DAAAVTTLRQALEGQGAVCEIVAPREGTLGGLPVDRQLSAASSVLYDAVVAADGALLSAS
ARAVFFVLEAFRHGKAVGAVGSGRQLVEAARLPNDVGVIVGDDIATAFAEAVAGHRFYDR
DVSGVPA
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccgagcgtgacgcgaaggaccgccagctcgacgagcaccgcgtacctctcgac
gaccacaccatgaccaccgaccagggcatcccggtcgacgacacggacaactcgctcaag
gccggcacccgcgggccgaccctcatggaggacttccacttccgcgagaagatcacccgc
ttcgaccacgagcgcatccccgagcgggtggtgcacgcccgcggctccggcgcgtacggg
atcttcgagctgtacgagccgctcggcgagtacacctgcgccgagttcctgaacgacacc
tccgcgcggacgcccaccttcgtgcgcttctccaccgtcgccggcttccgcggctccgcc
gacaccgtacgcgacgtgcgcggcttcgccacgaagttctacaccggccagggcaacttc
gacatcgtcggcaacaacatccccgtcttcttcatccaggacggcatcaagttccccgac
ttcgtgcacgccgtcaaacccgagccgcactgggagatcccgcaggcgcagtcggcgcac
gacacgttctgggacttcgtccagctccagcccgagtcgctgcacatggtcatgtgggtg
atgtccgaccgggcgatcccgcgcagctaccggatgatgcaggggttcggggtgcacacg
ttccggctggtcaacgcccaggggcaggggacgttcgtcaagtggcactggcggcccagg
ctcgggacgtactcgctggtgtgggacgaggtgctgcgcatccagggcaacgaccccgac
ttcaaccgccgcgacctctgggaggcgatcgagcggggcgcctaccccgagtacgagctg
tgcgtgcagctcgtgcccgagtcgcgcgagcacgacttcgacttcgacctgctcgacccc
acgaagatcatccccgaggagcaggtcccgctgcggcccatcggcaagatgacgctcacc
cgcaacccgcagaacttccacgccgagaccgagcaggtcgccttccacacggccaacgtc
gtgcccggcatcgacttcaccaacgaccccctgctccaggccaggaacttctcctacctc
gacacccagctcctgcgcctcggcggccccaacttcacgcagatccccatcaaccggccg
atcgcccccgtacgcaacgaccagcgcgacggcttccaccagcacctgatccacgagtcg
cgcaccagctacgcccccaactccatcagcggcggctgccccgccgcccgggacggctac
cggcactaccaggagaaggtggaaggcaccaagatccgccggcgcagccccagcttcgag
gaccattacagccaggccaccctgttctggaacagcatggccgactgggagaagcggcac
atcgtggccgcgttcctgttcgagctggggcacgtcgagcggccgcccatcaagcaggcc
gtggtcgcccacctcggcagaatccatcccgacctcggggcggccgtcgcgcagggcctc
ggcctgcccgcgcccggcggcggccaggtgcactcccgcacctcccccgccctcagcatg
accggccagccccgcagcgtcgccacccgcaagatcgccatcctgatggccgacggcacg
gacgccgccgccgtcaccaccctgcgccaggccctggagggccagggggccgtctgcgag
atcgtcgcgccccgcgagggcacgctcggcggcctcccggtggaccggcagctcagcgcg
gccagctccgtcctctacgacgcggtggtggccgccgacggcgccctcctgtccgcctcc
gcccgggccgtgttcttcgtcctggaggccttccgccacggcaaggcggtgggggccgtg
gggtcgggccggcagctcgtggaggcggcccggctgcccaacgacgtgggggtgatcgtc
ggggacgacatcgccaccgccttcgccgaggccgtggccgggcaccgcttctacgaccgg
gacgtttccggcgtgcccgcctga

DBGET integrated database retrieval system