KEGG   Nonomuraea sp. ATCC 55076: BKM31_01195Help
Entry
BKM31_01195       CDS       T04759                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
noa  Nonomuraea sp. ATCC 55076
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
268599..269600
Genome map
AA seq 333 aa AA seqDB search
MASPYIELEVGERTVKVTNPDKVYFPEIGATKRELVEYYVSVGEGALRALKDRPTNIKRH
PDGVQTEAIYQKRMPPKHPDWLESVTVTFPSGRTAHSLRVTEVAAIAYCANLGTIDFHPW
QVRAADVEHPDELRIDLDPQPGLEFDAARRAAFLTRDVLGELGMEGFVKTSGNRGAHIAV
RIEPLWDFIQVRHAGIALARAVEARDPSLVTTAWWKEERGERVFIDYNQNARDRTVASAY
SVRAKPHAPVSTPLTWDELADADPRDFDIRTVPARFAKLGDVHAAIDDRAYSIEPLLELY
ARDERGDLPYPPNYPKMPGEPKRVQPSKARSDT
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgccgtacatagagctcgaggtgggggagcggaccgtcaaggtcaccaatccc
gacaaggtgtattttccggagatcggagccactaagcgggagctggtcgaatactacgtg
agcgtcggcgagggtgccctgcgggcgctgaaggaccggcccacgaacatcaagcgccac
cccgacggcgtccagaccgaggcgatctaccagaagcgcatgccgcccaagcaccccgac
tggctggagtcggtcaccgtgaccttccccagcggccgcacggcgcattcgctgcgggtc
accgaggtcgcggccatcgcctactgcgccaacctcggcaccatcgacttccacccgtgg
caggtgcgggccgccgacgtcgagcaccccgacgagctgcgcatcgacctcgacccgcag
ccggggctggagttcgacgccgcgcgcagggccgcgttcctgacgagagacgtgctcggc
gagctgggcatggagggcttcgtgaagacctcgggcaaccggggcgcgcacatcgccgtc
cgcatcgagccgctctgggacttcatccaggtccgccacgccggcatcgccctggccagg
gccgtcgaggcccgcgacccgagcctcgtgaccaccgcctggtggaaggaggagcggggc
gagcgggtcttcatcgactacaaccagaacgccagagaccgcaccgtggccagcgcctac
tcggtgcgcgccaagccgcacgcccccgtctccacgccgctgacctgggacgagctggcc
gacgccgatccgcgcgacttcgacatccgcacggtgccggcccgcttcgccaagctgggc
gacgtgcacgcggccatcgacgaccgcgcgtactcgatcgagccccttctggagctgtac
gcgcgggacgagcgcggcgacctgccgtacccgccgaactatccgaagatgcccggcgag
cccaagcgcgtccagccgagcaaggccaggtccgacacctag

DBGET integrated database retrieval system