KEGG   Nonomuraea sp. ATCC 55076: BKM31_35000Help
Entry
BKM31_35000       CDS       T04759                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
noa  Nonomuraea sp. ATCC 55076
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:noa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BKM31_35000
   00650 Butanoate metabolism
    BKM31_35000
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BKM31_35000
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BKM31_35000
Enzymes [BR:noa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BKM31_35000
Amino acid related enzymes [BR:noa01007]
 Aminotransferase (transaminase)
  Class III
   BKM31_35000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(7841583..7842863)
Genome map
AA seq 426 aa AA seqDB search
MSELLARHRAVMPNWLALNYNDPIEIVSGKGNRVIDADGKSYLDFFAGILTNMIGYDIPE
VREAVERQLATGVVHTSTVYLLRGQVELAEKIARLSGIPDAKVFFTNSGTEANETALLLA
TYARKSDQVLAMRQSYHGRSFGAISVTSNRSWKNNSLSPLNVHFLHGADRHLTQFKGLSD
ADYIQACVDDLRHVLATSVSNDVAALIAEPIQGVGGFTMAPDGLFAAYKEVLDEQGILFI
SDEVQTGWGRTGSAFFGIENHGVTPDMITFAKGLGNGFAVGGVVARGDLMDAPHAVGLST
FGGNPISMAAANATLDYVLDHDLQANAARTGEIIISGLKAAAERLPVVKDVRGKGLMFAI
ELETPAQAARFMEETKRAGLLAGKGGLYGTAIRMAPPLTLTVDEATEGLGIIVTALETIN
AEAAAQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcttctcgcgcgccaccgggcagtgatgccgaactggttggccctcaactac
aacgaccccatcgagatcgtcagcggcaagggcaaccgcgtcatcgacgcggacggcaag
agctacctcgacttcttcgccgggatcctgaccaacatgatcgggtacgacatccccgag
gtacgcgaggccgtcgagcgccagctcgccaccggcgtggtgcacaccagcaccgtctac
ctgctgcgcggccaggtcgagctggccgagaagatcgcgcggctgtccggcatccccgac
gccaaggtcttcttcaccaactccggcaccgaggccaacgagaccgcgctgctgctggcc
acctacgcgcgcaagagcgaccaggtgctggccatgcgccagagctaccacggccgcagc
ttcggcgcgatcagcgtcacctccaaccggtcgtggaagaacaactcgctctccccgctc
aacgtgcacttcctgcacggcgccgaccggcacctgacgcagttcaagggcctgtcggac
gccgactacatccaggcgtgcgtggacgacctgcgccacgtgctggccacctccgtctcc
aacgacgtggcagcgctgatcgccgagccgatccagggcgtgggcggcttcacgatggcc
cccgacgggctgttcgccgcgtacaaggaggtgctggacgagcagggcatcctgttcatc
tcggacgaggtgcagaccggctggggccggaccggcagcgcgttcttcggcatcgagaac
cacggcgtgacgcccgacatgatcacgttcgcgaaggggctcggcaacggcttcgcggtc
ggcggcgtcgtcgcgcgcggcgacctcatggacgcgccgcacgccgtgggcctgtccacg
ttcggcggcaacccgatctccatggccgccgccaacgccaccctcgactacgtgctcgac
cacgacctccaggccaacgccgcccgtaccggggagatcatcatcagcgggctcaaggcc
gccgccgagcggctgcccgtcgtcaaggacgtgcgcggcaagggcctgatgttcgctatc
gagctggagaccccggcgcaggccgcgcgcttcatggaggagaccaagcgggccggcctg
ctggcgggcaagggcggcctgtacggcaccgccatccgcatggccccgcccctcacgctc
acggtggacgaggccaccgagggcctgggcatcatcgtcaccgccctcgaaacgatcaac
gcagaggcggcagcgcagtga

DBGET integrated database retrieval system