KEGG   Nonomuraea sp. ATCC 55076: BKM31_45815Help
Entry
BKM31_45815       CDS       T04759                                 

Definition
(GenBank) hypothetical protein
Organism
noa  Nonomuraea sp. ATCC 55076
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(10137312..10139054)
Genome map
AA seq 580 aa AA seqDB search
MSEFESFMARLGDHAARVPGRVALVFRDGRGEEESHTYRELWSAARSAGAWLAERVRPGE
RVLLSYPSGAEFVTAFLGCLYAGAVAVPAPVPDAYRQHHDRITAVCGDAAPSLILTDEAH
LDAVTGWVREAGLGVEVTVACRAEPGEPAPVTPESLAFLQYTSGSTSEAKGVMVGHGNLV
DNILVGRRLLDLDEGARFCSWLPVYHDMGLVAMILLPLHLGGTAVLMSPTTFLRRPWTWL
EAIAEHGAEVSAAPDFAYDLCARRVTDEQIRGLDLSGWRHACNGAEPVDAGTLARFADRF
AAAGLKPESLTAGYGMAEATLFISGTAPGHAPVVTKVGAAALEHDVLEPDPAGRPLVSCG
RPRALDVRIVDPATGAELPEGRVGEIWVRGDGVARGYWRREAETRRCFGATTAAGEPGFL
RTGDLGARLDGELYVTGRIKDMMIVHGRNLYPHDVERALTGLSPATEGLPSCVFSVAAPR
EELVVVQEVRSRAVPGQALSVLAGEIRSALGRRLGVSVANVCFVRPGGIRRTTSGKIRRP
AMKKLFVAGLLGATHEDLSPGVISHYRTPGAAGELREGGS
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgagttcgagagtttcatggcccggctgggtgatcacgcggcgcgggtgcccgga
cgggtggcgctggtgttccgcgacggtcgcggcgaggaggagagccacacgtaccgggag
ctgtggtccgccgcccggtcggcgggcgcgtggctggcggaacgggtgcgtccgggggag
cgggtgctgctgtcgtacccgtccggggccgagttcgtcacggcgttcctcggctgtctg
tacgcgggcgcggtcgccgtccccgcacctgtgccggacgcctaccggcagcaccacgac
cgcatcacggccgtctgcggggacgcggccccgtcgctgatcctgaccgacgaggcccac
ctcgacgcggtcaccggctgggtgcgcgaggccgggctcggcgtcgaggtgacggtggcc
tgccgcgccgagccgggcgagccggccccggtcacgccggagtcgctggccttcctccag
tacacctccggctccaccagcgaggcgaagggcgtgatggttgggcacggcaacctggtc
gacaacatcctcgtcggccgccgcctgctcgacctggacgagggcgcccgcttctgcagc
tggctgcccgtctaccacgacatgggcctggtggcgatgatcctgctgccgctccacctc
ggcgggaccgcggtgctcatgtcgccgacgacgttcctgcgccgcccgtggacgtggctg
gaggcgatcgccgagcacggcgccgaggtgagcgcggcccccgacttcgcgtacgacctg
tgcgcccgccgcgtcaccgacgagcagatcagggggctcgacctgtcgggctggcggcac
gcctgcaacggcgccgagccggtggacgcgggcacgctggccaggttcgccgaccggttc
gccgcggccgggctcaagcccgagtcgctgaccgccgggtacggcatggccgaggccacg
ctgttcatctccggcaccgcgcccggccacgcgcccgtcgtcaccaaggtcggcgcggcg
gcgctggagcatgacgtgctggagcccgacccggcgggccgcccgctggtgagctgcggc
cggccgcgcgccctggacgtgcgcatcgtggaccccgccaccggcgccgagctgcccgag
gggcgggtcggcgagatctgggtacgcggcgacggcgtggcgcgcggctactggcggcgg
gaggcggagacccggcgctgcttcggcgcgaccaccgccgcaggagagcccgggttcctc
cgcaccggcgacctcggcgcccgcctggacggcgagctgtacgttaccggccggatcaag
gacatgatgatcgtccacgggcgcaacctctacccgcacgacgtcgaaagggccctgacc
gggctgagcccggccacggaggggctgccgtcctgcgtgttctcggtggcggcgccccgt
gaggagctggtggtcgtccaggaggtcaggagccgggccgtgcccggccaggcgctgtcc
gtcctggccggggagatcaggtcggccctcggccggcggctgggtgtgagcgtggcgaac
gtctgcttcgtgcggccgggcggcatccgccgaacgacgagcggcaagatccggcggccc
gcgatgaagaagctgttcgtcgcggggctgctcggcgcgacccacgaggacctctccccc
ggcgtcatctcgcactaccgaacgccgggcgccgccggggagcttcgggagggtggctca
tga

DBGET integrated database retrieval system