KEGG   Nonomuraea sp. ATCC 55076: BKM31_47365Help
Entry
BKM31_47365       CDS       T04759                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
noa  Nonomuraea sp. ATCC 55076
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:noa00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BKM31_47365
Enzymes [BR:noa01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BKM31_47365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
10468064..10469260
Genome map
AA seq 398 aa AA seqDB search
MLDRDQCLALDAEDPLREFRHEFVLPDGVIYLVGNSLGALPRRTAERVRRTVEDEWGRQL
VGGWNHAGWYEQPLTTGDRIAPLIGAGPGQVVVGNTTSIAVYQAVAAALRLRPERRVIVS
DLRNFPTDHYIVQGLAGLLGGYELRDLSEGSFEDAAVVLLSEVDYRTGARADVPAVTAAA
HAAGALIVWDVCHSVGAMEVDVSAADFAVGCTYKYLNAGPGAPAFLYVNPRHHAAAENVL
SGWHGHAEPFAFEADYRPAEGVRRFAVSTPHVLSFAALEAALDVWERVPMAQVRAKSMAL
GELFVELVGDRLELASPADPAARGSQISLRHPDGYPVMRALIDRGVHGDFRAPDVLRFGF
APLYIGYADVYDAATTLLEVLDKELWRDDKYATRLAVT
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atcttggaccgcgaccagtgcctcgccctcgacgccgaggacccgctgcgggagttccgg
cacgagttcgtgctgcccgacggcgtgatctacctcgtcggcaactcgctgggcgcgctg
ccccgccgtaccgccgagcgggtgcgcaggacggtcgaggacgaatggggcaggcagctc
gtcggcgggtggaaccacgcgggctggtacgagcagccgctcaccaccggcgaccggatc
gccccgctcatcggcgccggccccggccaggtcgtcgtgggcaacaccacctcgatcgcc
gtctaccaggccgtggcggcggcgctccggctgcggcccgagcggcgcgtgatcgtctcc
gacctccgcaacttccccaccgaccactacatcgtgcagggcctggccgggctgctgggc
ggctacgagctgcgcgacctcagcgaggggagcttcgaggacgccgccgtggtgctgctg
tcggaggtggactaccgcacgggcgcccgcgccgacgtgcccgcggtgaccgccgccgcg
cacgccgcgggggcgctcatcgtgtgggacgtgtgccacagcgtcggcgccatggaggtg
gacgtctccgcggccgacttcgcggtgggatgcacgtacaagtacctgaacgccggtccc
ggcgcgcccgcgttcctctacgtcaacccgcgccaccacgccgccgccgagaacgtgctg
tcgggctggcacggccacgccgagccgttcgcgttcgaggccgattaccggccggccgag
ggggtgcggcggttcgcggtgagcaccccgcacgtgctgtcgttcgcggcgctggaggcg
gcgctcgacgtgtgggagcgggtgccgatggcgcaggtcagagccaagagcatggcgctc
ggcgagctgttcgtcgagctggtcggcgaccggctggagctggcctcgcccgccgacccg
gccgcgcgcggcagccagatctcgttgcgccaccccgacggctacccggtgatgcgggcg
ctgatcgaccggggcgtgcacggcgacttccgcgcgcccgacgtgctcaggttcggcttc
gcgccgctctacatcggctacgccgacgtgtacgacgctgcgaccacgctgctggaggtg
ctcgacaaggagctgtggcgcgacgacaagtacgcgacccgcctggcggtcacctga

DBGET integrated database retrieval system