KEGG   Nitrosococcus oceani: Noc_0332Help
Entry
Noc_0332          CDS       T00281                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
noc  Nitrosococcus oceani
Pathway
noc00630  Glyoxylate and dicarboxylate metabolism
noc00710  Carbon fixation in photosynthetic organisms
noc01100  Metabolic pathways
noc01120  Microbial metabolism in diverse environments
noc01200  Carbon metabolism
Module
noc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Noc_0332
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Noc_0332
Enzymes [BR:noc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Noc_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABA56858
JGI: Noc0332
UniProt: Q3JE88
LinkDB All DBs
Position
complement(359185..359622)
Genome map
AA seq 145 aa AA seqDB search
MMTNHGNRITQGQFSFLPDLTDEQILAQIKYALKNDWAVNVEYTDDPHPRNTYWEMFGIP
MFDLKDPAGIMMEINDCRKTYPNHYVRVTAFNSHRGVESPCMSFIVNRPKNEPGFGLVRQ
EVDGRHINYTVRSYAADRPEGERYQ
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaatcatggaaaccgtatcactcagggacagttctcgttcctgcctgattta
acggacgagcagattttagcgcaaatcaaatatgcgctgaaaaatgattgggcggtcaat
gtggaatacactgatgatccccatccacgcaatacttattgggaaatgtttggcattcct
atgttcgatctgaaagatcccgccgggatcatgatggaaatcaacgattgccgcaaaacc
taccctaatcactacgttcgggtaacggcgtttaacagccatcggggcgttgagtcaccc
tgtatgtcctttatcgtcaatcgccccaaaaacgagcctggctttgggttggtgcggcag
gaagtagatggccgccatatcaactataccgtacgcagctatgcagctgacaggccggaa
ggcgagcggtatcaataa

DBGET integrated database retrieval system