KEGG   Nitrosococcus oceani: Noc_0830Help
Entry
Noc_0830          CDS       T00281                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
noc  Nitrosococcus oceani
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Noc_0830
Enzymes [BR:noc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Noc_0830
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Noc_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
907053..910367
Genome map
AA seq 1104 aa AA seqDB search
MNPRGEELAWQDDPLWYKDAIIYQLHVRAFFDSNNDGTGDFRGLTQKLDYIQDLGVNAIW
LLPFYPSPLRDDGYDIADYRNIYPDYGTRRDVRHFVREAHRRGLKVITELVINHTSDQHP
WFQAARRAPPGSAKRDFYVWSDTDQKFPETRIIFTDTETSNWAWDPVAKAYYWHRFFSHQ
PDLNHNNPQVVRAVIRVMRFWLDMGVDGLRLDAIPYLCVREGTHNENLPESHEVLKEMRA
VVDEHYQGRMFLAEANQWPEDVREYFGDGDECHMAYHFPLMPRMYMAIAQEDRHPITEIM
NQTPDIPQTCQWAIFLRNHDELTLEMVTDKERDYMYQSYAANPRMRVNVGIRRRLAPLMD
NDLDKIRLMNSLLFSMPGSPIIYYGDEIGMGDNIYLGDRNSVRTPMQWSPDRNAGFSKTD
PQRLFLPPIMDPIYGYEGVNVEAQSRAPSSLLNWMKRLLAVRKSIKTFGRGTLAFLRPGN
RKILAYVREWEGEAILCVANLSRCAQPVELDLSRFEGRVPLELMGHTPFPPIGELPYLLT
LPGHGFYWFRLAMDVAEPAWHEQRSPPAELPVLVLFDGWDSLFPERVDPSRQRMAEKLGR
QLEQALGDFLLAQRWFAAKGEKIERIALEQMEELGNWLLARVRVEFTESEAQSYFIPLAI
AWGEGDEEPIRRLLPATIAKIRRQARLGILYDALEDINFSQALVMAMGQHREILFGAGRL
KFSPTTAFEKLVYSASLEQLRRPAVEGTNSTLILDNRLFLKIYRYLEEGINSEREIGYFL
TEISPFPHIAPLAGTLEYISPKEKVITLALLQGFVSNQGDAWAYTVAYLERFLEHCLAKP
LEEVATELDKNHEDYLRKITLLGRRTGELHQALAKETGNPAFDPEPIVSADLISWRKRLE
ADIECTFKKLAQRKNTFPESLRNDVEWFLRSGEILRQRLCLNSSILQTVKTRYHGDYHLG
QVLVAEDDLVIIDFEGEPARPLRERRKKHSPLRDVAGMLRSFNYAAVVALRHCTAERPED
QVLLMPLLHAWEQQAREYFLTGYREGMRDCPSYPVDSEQAHDLITLFTLEKALYELRYEL
DNRPAWVEVPLRGLLAFLEEDEQK
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacggggggaagaattagcctggcaagatgatccgctttggtataaagatgcc
attatctaccaactccatgttagggctttttttgatagtaataatgatggcacgggagat
ttccggggccttacccagaagttggactatatccaagatctgggcgtaaatgcgatctgg
ctgctgcccttttatccttctcctttgcgagatgatggctatgatattgcggattaccgc
aatatctatccggattatgggactcgcagggatgtgaggcactttgtgcgggaagcccac
cgccgtggcctcaaggttattaccgagctagtcatcaaccatacctcggatcagcaccct
tggtttcaggctgcccgcagggcgccaccaggatcggccaaacgggatttctacgtctgg
agcgataccgatcaaaaatttcccgagacccggattatcttcaccgatacggaaacttcc
aactgggcctgggacccggtggcgaaggcttactattggcatcggtttttctctcaccaa
cccgatctcaaccataacaacccccaggtggttagggcggtgatccgggtgatgcgtttt
tggctggatatgggtgtggacggactgcgtttagatgctattccctacctatgcgtgcgt
gagggaacccataacgaaaatcttcccgaaagtcatgaggtgcttaaagagatgcgggct
gtggtggacgagcattatcaaggccgcatgtttttggcggaggccaatcaatggccagaa
gatgtaagggaatattttggtgacggcgatgaatgccatatggcctaccattttcccctt
atgccgcgcatgtatatggcgattgcccaggaggatcgccatcctattactgagattatg
aaccaaactccggatattccccagacctgccaatgggccatctttttgcgtaaccatgat
gagctgactctggagatggtcaccgacaaagaacgtgactatatgtatcagagctatgcc
gctaaccctcgtatgcgggtgaatgtgggcatccggcggcgtttggcaccgttaatggac
aatgatttagacaagattcggttgatgaatagcttgcttttctctatgcctggctcgccc
attatttactatggagatgaaattggcatgggagataatatttatttgggtgatcgcaat
agtgtgcgtacccccatgcagtggagtcctgatcggaatgcgggtttttctaagaccgat
cctcagcgcttgtttttgccgcctatcatggaccccatttacggttatgagggcgttaac
gtggaagcccagagccgggcgccctcttccctcctcaattggatgaaacgtctgcttgca
gtgcgtaagagcattaagacctttggccgcggcacactagcatttcttcgtcctggaaac
cgtaaaatcttagcctatgtgcgggaatgggaaggggaagctattttatgtgttgctaat
ttgtcccgctgcgcccagccagtggaattggacctctcccgctttgaaggacgagtaccg
ctagaattgatgggacatacccctttccctcctattggcgaattgccctatttgctgact
ctgccgggccatggtttttattggttccggttggcaatggatgtagcggaacccgcttgg
catgagcagcgctcgccaccagctgagttaccagtgctagtgttatttgatggctgggat
agcttatttcctgagcgcgtcgatccctcccgccagcggatggccgaaaaattgggcagg
caattagagcaagcattaggggattttctgttagcgcagcgctggtttgctgccaaaggg
gagaagatagagcggatagcgttggagcagatggaggagttagggaattggctgctggcc
agagtgagggttgagttcaccgagtccgaagctcagtcttattttatcccgttagctatt
gcttggggagaaggggatgaagagcccatacggcgcttgctgcctgctaccatcgctaag
attcggcgacaagctcgtttaggtatcttatatgatgccttagaggatataaattttagc
caagcattagtcatggccatgggacagcatagggagatcctctttggagccggaagatta
aaattctcccccacgacggcttttgaaaagttggtctacagtgcttccctagagcaactg
cggcgcccggcggtggaaggtacaaacagcaccttgattttagataaccggctatttttg
aaaatctaccgttatttagaagaaggtatcaattcagagcgggagataggctatttcctt
accgaaatatcgccctttcctcatattgcccctctagcaggtaccttagagtatataagt
ccaaaagaaaaggtgataactctggctcttctgcaaggttttgtttccaaccagggagat
gcttgggcttataccgtggcttatttagaacgttttctagaacattgcctcgcaaaaccg
ctcgaagaagttgccactgaattggacaagaatcatgaggattatctaagaaaaataacc
ctcttgggccggcgcacgggggaattgcatcaggcgctggccaaggaaacggggaatccg
gcctttgatccggaacccattgtttctgctgatttgatatcttggagaaaacgcctggaa
gcagatattgagtgcactttcaagaagctagcacagcggaaaaacacttttcccgaatca
ctgcgcaacgacgtagaatggtttttgagatccggcgaaatcttgcggcaacggctttgt
ttaaattcttccatattgcaaactgtcaagactcgctatcatggtgattatcatttaggg
caagtactagtagcagaggatgatttggtcattattgattttgaaggcgagcctgctcgc
cccttaagggagcgtcggaaaaagcattcgccgctgcgggacgtagcgggtatgttgcga
tcatttaactatgctgctgtcgtagctctgcgccattgtacggcagaacgtcctgaagat
caggttttactcatgccactactacatgcttgggagcagcaggcgagggagtattttcta
actggctaccgggaggggatgagggattgtccttcttatcctgtagactcggaacaggct
cacgacttgatcacgctatttactttggaaaaggcactgtacgaactccgttacgagctc
gacaatcggccagcatgggtggaggtaccccttaggggattgcttgcgtttttggaagag
gatgagcagaaataa

DBGET integrated database retrieval system